Reactivity | HuSpecies Glossary |
Applications | WB, IHC |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IQVPNQEFGLSENEPGTNFVYAQFDGIMGLAYPALSVDEATTAMQGMVQEGALTSPVFSVYLSNQQGSSGGAVVFGGVDSSLYTGQI |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | PGC |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. IHC-F reactivity reported in (PMID: 29925878). |
||
Control Peptide |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Publication using NBP1-91011 | Applications | Species |
---|---|---|
Berglund E, Maaskola J, Schultz N et al. Spatial maps of prostate cancer transcriptomes reveal an unexplored landscape of heterogeneity Nat Commun 2018-06-20 [PMID: 29925878] (IHC-Fr, Human) | IHC-Fr | Human |
Secondary Antibodies |
Isotype Controls |
Diseases for Pepsinogen C/PGC/Progastricsin Antibody (NBP1-91011)Discover more about diseases related to Pepsinogen C/PGC/Progastricsin Antibody (NBP1-91011).
| Pathways for Pepsinogen C/PGC/Progastricsin Antibody (NBP1-91011)View related products by pathway.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | PGC |