Periostin/OSF-2 Antibody - BSA Free

Western Blot: Periostin Antibody [NBP1-59151] - Titration: 1 ug/ml Positive Control: 721_B cell lysate.

Immunohistochemistry-Paraffin: Periostin Antibody [NBP1-59151] - Human small intestine tissue at an antibody concentration of 5ug/ml.

Immunohistochemistry-Paraffin: Periostin Antibody [NBP1-59151] - Human uterus.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Periostin/OSF-2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to POSTN (periostin, osteoblast specific factor) The peptide sequence was selected from the N terminal of POSTN (NP_006466) and is located within the following region: RAAAITSDILEALGRDGHFTLFAPTNEAFEKLPRGVLERIMGDKVASEAL. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: POSTN
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 5 ug/ml
  • Immunohistochemistry-Paraffin 5 ug/ml
  • Western Blot 1.0 ug/ml
• Theoretical MW: 93 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Periostin/OSF-2 Antibody - BSA Free

• Fasciclin I-like
• MGC119510
• MGC119511
• OSF2
• OSF-2
• OSF-2osteoblast specific factor 2 (fasciclin I-like)
• OSF2periodontal ligament-specific periostin
• Osteoblast-specific factor 2
• PDLPOSTN
• periostin isoform thy2
• periostin isoform thy4
• periostin isoform thy6
• periostin isoform thy8
• Periostin
• periostin, osteoblast specific factor
• PNRP11-412K4.1
• POSTN
• TRIF52

Background

POSTN binds to heparin. Induces cell attachment and spreading and plays a role in cell adhesion. POSTN may play a role in extracellular matrix mineralization.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Periostin/OSF-2 Antibody (NBP1-59151)(1)

Publication using NBP1-59151

• Ratajczak-Wielgomas K, Grzegrzolka J, Piotrowska A et al. Expression of periostin in breast cancer cells Int. J. Oncol. 2017-10-01 [PMID: 28902360] (Human)

Bioinformatics

• Gene Symbol: POSTN
• Entrez:
  • 10631(Human)
• Uniprot:
  • Q15063()