PTHLH/PTHrP Antibody

Western Blot: PTHLH/PTHrP Antibody [NBP1-59322] - HepG2 cell lysate, Antibody Titration: 2.0ug/ml

Immunohistochemistry-Paraffin: PTHLH/PTHrP Antibody [NBP1-59322] - Human Lung Alveolar cells (indicated with arrows), 4-8ug/ml.

Western Blot: PTHLH/PTHrP Antibody [NBP1-59322] - Primary, Antibody Dilution: 1 : 1000 Secondary Antibody: Goat anti-rabbit HRP Secondary, Antibody Dilution: 1 : 2000.

Immunohistochemistry-Paraffin: PTHLH/PTHrP Antibody [NBP1-59322] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

PTHLH/PTHrP Antibody Summary

• Immunogen: Synthetic peptides corresponding to PTHLH (parathyroid hormone-like hormone) The peptide sequence was selected from the middle region of PTHLH. Peptide sequence YKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLS. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PTHLH
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
• Application Notes: This is a rabbit polyclonal antibody against PTHLH and was validated on Western Blot and immunohistochemistry-paraffin
• Theoretical MW: 20 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PTHLH/PTHrP Antibody

• BDE2
• HHM
• MGC14611
• Osteostatin
• parathyroid hormone-like hormone
• Parathyroid hormone-like protein
• parathyroid hormone-related protein
• PLPosteostatin
• PTHLH
• PTHR
• PTH-related protein
• PTHRP
• PTH-rP
• PTHRPparathyroid hormone-like related protein

Background

PTHLH is a member of the parathyroid hormone family. This hormone regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. This hormone is involved in lactation possibly by regulating the mobilization and transfer of calcium to the milk. The receptor of this hormone, PTHR1, is responsible for most cases of humoral hypercalcemia of malignancy. Four alternatively spliced transcript variants encoding two distinct isoforms have been observed.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PTHLH
• Uniprot:
  • P12272()