PTHLH/PTHrP Antibody Summary
Immunogen |
Synthetic peptides corresponding to PTHLH (parathyroid hormone-like hormone) The peptide sequence was selected from the middle region of PTHLH. Peptide sequence YKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLS. The peptide sequence for this immunogen was taken from within the described region. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
PTHLH |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:100-1:2000
- Immunohistochemistry 1:10-1:500
- Immunohistochemistry-Paraffin 1:10-1:500
|
Application Notes |
This is a rabbit polyclonal antibody against PTHLH and was validated on Western Blot and immunohistochemistry-paraffin |
Theoretical MW |
20 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Purity |
Protein A purified |
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for PTHLH/PTHrP Antibody
Background
PTHLH is a member of the parathyroid hormone family. This hormone regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. This hormone is involved in lactation possibly by regulating the mobilization and transfer of calcium to the milk. The receptor of this hormone, PTHR1, is responsible for most cases of humoral hypercalcemia of malignancy. Four alternatively spliced transcript variants encoding two distinct isoforms have been observed.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Gp, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Ca, Eq, Pm, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
Species: Hu, Rt
Applications: WB
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
Publications for PTHLH/PTHrP Antibody (NBP1-59322) (0)
There are no publications for PTHLH/PTHrP Antibody (NBP1-59322).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PTHLH/PTHrP Antibody (NBP1-59322) (0)
There are no reviews for PTHLH/PTHrP Antibody (NBP1-59322).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PTHLH/PTHrP Antibody (NBP1-59322) (0)
Secondary Antibodies
| |
Isotype Controls
|
Other Available Formats
Additional PTHLH/PTHrP Products
Bioinformatics Tool for PTHLH/PTHrP Antibody (NBP1-59322)
Discover related pathways, diseases and genes to PTHLH/PTHrP Antibody (NBP1-59322). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for PTHLH/PTHrP Antibody (NBP1-59322)
Discover more about diseases related to PTHLH/PTHrP Antibody (NBP1-59322).
| | Pathways for PTHLH/PTHrP Antibody (NBP1-59322)
View related products by pathway.
|
PTMs for PTHLH/PTHrP Antibody (NBP1-59322)
Learn more about PTMs related to PTHLH/PTHrP Antibody (NBP1-59322).
| | Research Areas for PTHLH/PTHrP Antibody (NBP1-59322)
Find related products by research area.
|
Blogs on PTHLH/PTHrP