PTHLH/PTHrP Antibody

Images

 
Western Blot: PTHLH/PTHrP Antibody [NBP1-59322] - HepG2 cell lysate, Antibody Titration: 2.0ug/ml
Immunohistochemistry-Paraffin: PTHLH/PTHrP Antibody [NBP1-59322] - Human Lung Alveolar cells (indicated with arrows), 4-8ug/ml.
Western Blot: PTHLH/PTHrP Antibody [NBP1-59322] - Primary, Antibody Dilution: 1 : 1000 Secondary Antibody: Goat anti-rabbit HRP Secondary, Antibody Dilution: 1 : 2000.
Immunohistochemistry-Paraffin: PTHLH/PTHrP Antibody [NBP1-59322] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PTHLH/PTHrP Antibody Summary

Immunogen
Synthetic peptides corresponding to PTHLH (parathyroid hormone-like hormone) The peptide sequence was selected from the middle region of PTHLH. Peptide sequence YKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLS. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTHLH
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against PTHLH and was validated on Western Blot and immunohistochemistry-paraffin
Theoretical MW
20 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PTHLH/PTHrP Antibody

  • BDE2
  • HHM
  • MGC14611
  • Osteostatin
  • parathyroid hormone-like hormone
  • Parathyroid hormone-like protein
  • parathyroid hormone-related protein
  • PLPosteostatin
  • PTHLH
  • PTHR
  • PTH-related protein
  • PTHRP
  • PTH-rP
  • PTHRPparathyroid hormone-like related protein

Background

PTHLH is a member of the parathyroid hormone family. This hormone regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. This hormone is involved in lactation possibly by regulating the mobilization and transfer of calcium to the milk. The receptor of this hormone, PTHR1, is responsible for most cases of humoral hypercalcemia of malignancy. Four alternatively spliced transcript variants encoding two distinct isoforms have been observed.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Gp, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-88573
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87781
Species: Hu, Mu
Applications: WB, IHC, IHC-P
7270-IL/CF
Species: Hu
NBP1-40067
Species: Hu, Mu, Po, Bv, Ca, Eq, Pm, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
H00004340-B01P
Species: Hu, Rt
Applications: WB
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow

Publications for PTHLH/PTHrP Antibody (NBP1-59322) (0)

There are no publications for PTHLH/PTHrP Antibody (NBP1-59322).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTHLH/PTHrP Antibody (NBP1-59322) (0)

There are no reviews for PTHLH/PTHrP Antibody (NBP1-59322). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PTHLH/PTHrP Antibody (NBP1-59322) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PTHLH/PTHrP Products

Bioinformatics Tool for PTHLH/PTHrP Antibody (NBP1-59322)

Discover related pathways, diseases and genes to PTHLH/PTHrP Antibody (NBP1-59322). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PTHLH/PTHrP Antibody (NBP1-59322)

Discover more about diseases related to PTHLH/PTHrP Antibody (NBP1-59322).
 

Pathways for PTHLH/PTHrP Antibody (NBP1-59322)

View related products by pathway.

PTMs for PTHLH/PTHrP Antibody (NBP1-59322)

Learn more about PTMs related to PTHLH/PTHrP Antibody (NBP1-59322).
 

Research Areas for PTHLH/PTHrP Antibody (NBP1-59322)

Find related products by research area.

Blogs on PTHLH/PTHrP

There are no specific blogs for PTHLH/PTHrP, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PTHLH/PTHrP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PTHLH
Uniprot