Myelin PLP Antibody


Western Blot: Myelin PLP Antibody [NBP1-87781] - Analysis in control (vector only transfected HEK293T lysate) and pLP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T more
Orthogonal Strategies: Immunohistochemistry-Paraffin: Myelin PLP Antibody [NBP1-87781] - Staining in human cerebral cortex and pancreas tissues using anti-PLP1 antibody. Corresponding PLP1 RNA-seq data are more
Immunohistochemistry-Paraffin: Myelin PLP Antibody [NBP1-87781] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: Myelin PLP Antibody [NBP1-87781] - Staining of human pancreas shows low expression as expected.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

Myelin PLP Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTGGQKGRGSRGQHQAHSLERVCHCLGKWLGHPDKFVGI
Oligodendrocyte Marker
Specificity of human Myelin PLP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Myelin PLP Protein (NBP1-87781PEP)
Reviewed Applications
Read 1 Review rated 5
NBP1-87781 in the following applications:

Read Publication using
NBP1-87781 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Myelin PLP Antibody

  • DM-20
  • HLD1
  • Lipophilin
  • major myelin proteolipid protein
  • MMPL
  • Myelin PLP
  • myelin proteolipid protein
  • PLP
  • PLP/DM20
  • PLP1
  • PMD
  • proteolipid protein 1
  • spastic paraplegia 2, uncomplicated
  • SPG2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
Species: Hu
Applications: IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, H, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P, IP, RNAi
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE, IF
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Myelin PLP Antibody (NBP1-87781)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Review for Myelin PLP Antibody (NBP1-87781) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Other.

Reviews using NBP1-87781:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin Myelin PLP NBP1-87781
reviewed by:
IHC-P Other 04/25/2014


Special ApplicationsDAB application

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Myelin PLP Antibody (NBP1-87781) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Myelin PLP Antibody (NBP1-87781)

Discover related pathways, diseases and genes to Myelin PLP Antibody (NBP1-87781). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Myelin PLP Antibody (NBP1-87781)

Discover more about diseases related to Myelin PLP Antibody (NBP1-87781).

Pathways for Myelin PLP Antibody (NBP1-87781)

View related products by pathway.

PTMs for Myelin PLP Antibody (NBP1-87781)

Learn more about PTMs related to Myelin PLP Antibody (NBP1-87781).

Research Areas for Myelin PLP Antibody (NBP1-87781)

Find related products by research area.

Blogs on Myelin PLP

There are no specific blogs for Myelin PLP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Application: IHC-P
Species: Other


Gene Symbol PLP1