Myelin PLP Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Myelin PLP Antibody [NBP1-87781] - Staining in human cerebral cortex and pancreas tissues using anti-PLP1 antibody. Corresponding PLP1 RNA-seq data are ...read more
Immunohistochemistry-Paraffin: Myelin PLP Antibody [NBP1-87781] - Border of a demyelinated lesion. Image submitted by a verified customer review.
Immunohistochemistry-Paraffin: Myelin PLP Antibody [NBP1-87781] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: Myelin PLP Antibody [NBP1-87781] - Staining of human pancreas shows low expression as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Myelin PLP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTGGQKGRGSRGQHQAHSLERVCHCLGKWLGHPDKFVGI
Marker
Oligodendrocyte Marker
Predicted Species
Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. WB reported in literature (PMID: 26209807). Myelin PLP antibody validated for IHC-P from a verified customer review.
Control Peptide
Myelin PLP Protein (NBP1-87781PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-87781 in the following applications:

Publications
Read Publications using
NBP1-87781 in the following applications:

  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 26209807).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Myelin PLP Antibody

  • DM-20
  • HLD1
  • Lipophilin
  • major myelin proteolipid protein
  • MMPL
  • Myelin PLP
  • myelin proteolipid protein
  • PLP
  • PLP/DM20
  • PLP1
  • PMD
  • proteolipid protein 1
  • spastic paraplegia 2, uncomplicated
  • SPG2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-717
Species: Bv, Ca, Ch, Fe, Gp, Hu, Ma, Mu, Po, Rb, Rt, Sh
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
AF2307
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
NBP1-88573
Species: Hu
Applications: IHC, IHC-P, WB
538-MG
Species: Rt
Applications: BA
H00004340-B01P
Species: Hu, Rt
Applications: WB
NBP2-46617
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
6507-IL/CF
Species: Hu
Applications: BA
DY417
Species: Mu
Applications: ELISA
H00000875-M01
Species: Ba, Hu, Mu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
202-IL
Species: Hu
Applications: BA
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP2-32887
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NB100-1607
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IP, WB
NBP2-46376
Species: Hu
Applications: IHC, WB

Publications for Myelin PLP Antibody (NBP1-87781)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Review for Myelin PLP Antibody (NBP1-87781) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Other.

Reviews using NBP1-87781:
Filter by Applications
IHC-P
(1)
All Applications
Filter by Species
Other
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin Myelin PLP NBP1-87781
Enlarge
5
reviewed by:
Verified Customer
IHC-P Other 04/25/2014
View

Summary

ApplicationImmunohistochemistry-Paraffin
SpeciesOther
Special ApplicationsDAB application

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Myelin PLP Antibody (NBP1-87781) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Myelin PLP Products

Bioinformatics Tool for Myelin PLP Antibody (NBP1-87781)

Discover related pathways, diseases and genes to Myelin PLP Antibody (NBP1-87781). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Myelin PLP Antibody (NBP1-87781)

Discover more about diseases related to Myelin PLP Antibody (NBP1-87781).
 

Pathways for Myelin PLP Antibody (NBP1-87781)

View related products by pathway.

PTMs for Myelin PLP Antibody (NBP1-87781)

Learn more about PTMs related to Myelin PLP Antibody (NBP1-87781).
 

Research Areas for Myelin PLP Antibody (NBP1-87781)

Find related products by research area.

Blogs on Myelin PLP

There are no specific blogs for Myelin PLP, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Verified Customer
04/25/2014
Application: IHC-P
Species: Other

Bioinformatics

Gene Symbol PLP1