Pentraxin 3/TSG-14 Antibody - BSA Free Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: GFDETLAFSGRLTGFNIWDSVLSNEEIRETGGAESCHIRGNIVGWGVTEIQPHGGAQYVS |
Predicted Species |
Rat (90%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
PTX3 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Reactivity Notes
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for Pentraxin 3/TSG-14 Antibody - BSA Free
Background
Pentraxin 3 (PTX3) is the prototypic member of the long pentraxin family sharing the C-terminal domain with short pentraxins (C-reactive protein and serum amyloid P component) and containing a unique N-terminal domain. The protein is a soluble pattern recognition receptor and represents a nonredundant component of the humoral innate immunity against selected pathogens. PTX3 is rapidly produced and released at inflammatory sites by diverse cell types including monocytes/macrophages, endothelial cells, vascular smooth muscle cells, fibroblasts, and adipocytes. It interacts with several ligands, including growth factors, extracellular matrix components and selected pathogens. PTX3 has been implicated in vascular damage, angiogenesis, atherosclerosis, and restenosis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ELISA, Flow, Func, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Mu
Applications: ELISA
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Publications for Pentraxin 3/TSG-14 Antibody (NBP2-49595) (0)
There are no publications for Pentraxin 3/TSG-14 Antibody (NBP2-49595).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Pentraxin 3/TSG-14 Antibody (NBP2-49595) (0)
There are no reviews for Pentraxin 3/TSG-14 Antibody (NBP2-49595).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Pentraxin 3/TSG-14 Antibody (NBP2-49595) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Pentraxin 3/TSG-14 Products
Research Areas for Pentraxin 3/TSG-14 Antibody (NBP2-49595)
Find related products by research area.
|
Blogs on Pentraxin 3/TSG-14