PDZK1 Antibody - BSA Free

Western Blot: PDZK1 Antibody [NBP1-82573] - Analysis in control (vector only transfected HEK293T lysate) and PDZK1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: PDZK1 Antibody [NBP1-82573] - Staining in human kidney and lymph node tissues using anti-PDZK1 antibody. Corresponding PDZK1 RNA-seq data are presented for the same tissues.

Western Blot: PDZK1 Antibody [NBP1-82573] - Analysis in human cell line TD47D.

Immunohistochemistry-Paraffin: PDZK1 Antibody [NBP1-82573] - Staining of human kidney shows strong cytoplasmic and luminal positivity in tubule cells.

Immunohistochemistry-Paraffin: PDZK1 Antibody [NBP1-82573] - Staining of human lymph node shows low expression as expected.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PDZK1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PDZK1 Antibody - BSA Free (NBP1-82573) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EDASHEEVVEKVKKSGSRVMFLLVDKETDKRHVEQKIQFKRETASLKLLPHQPRIVEMKKGSNGYGFYLRAGSEQKGQIIKDIDSGSPAEEAGLKNNDLVVAVNGESVET
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PDZK1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PDZK1 Protein (NBP1-82573PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (85%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PDZK1 Antibody - BSA Free

• CAP70
• CFTR-associated protein of 70 kDa
• CLAMP
• Na(+)/H(+) exchanger regulatory factor 3
• Na/Pi cotransporter C-terminal-associated protein 1
• NaPi-Cap1
• NHERF3
• NHERF-3
• NHERF3PDZD1Na(+)/H(+) exchange regulatory cofactor NHE-RF3
• PDZ domain containing 1
• PDZ domain-containing protein 1
• PDZ-containing kidney protein 1
• PDZD1
• PDZK1
• Sodium-hydrogen exchanger regulatory factor 3

Background

PDZK1 is a scaffold protein that connects plasma membrane proteins and regulatory components, regulating their surface expression in epithelial cells apical domains. It may be involved in the coordination of a diverse range of regulatory processes for ion transport and second messenger cascades. In complex with SLC9A3R1, PDZK1 may cluster proteins that are functionally dependent in a mutual fashion and modulate the trafficking and the activity of the associated membrane proteins. It may also play a role in the cellular mechanisms associated with multidrug resistance through its interaction with ABCC2 and PDZK1IP1. PDZK1 may potentiate the CFTR chloride channel activity. PDZK1 functions to connect SCARB1 with the cellular machineries for intracellular cholesterol transport and/or metabolism and may be involved in the regulation of proximal tubular Na(+)-dependent inorganic phosphate cotransport, therefore playing an important role in tubule function .

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PDZK1