SLC22A11 Antibody

Images

 
Western Blot: SLC22A11 Antibody [NBP1-69536] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: SLC22A11 Antibody [NBP1-69536] - This Anti-SLC22A11 antibody was used in Western Blot of Fetal Liver tissue lysate at a concentration of 1ug/ml.
Western Blot: SLC22A11 Antibody [NBP1-69536] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Western Blot: SLC22A11 Antibody [NBP1-69536] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC22A11 Antibody Summary

Immunogen
Synthetic peptides corresponding to SLC22A11(solute carrier family 22 (organic anion/urate transporter), member 11) The peptide sequence was selected from the C terminal of SLC22A11. Peptide sequence ASSLVVLFFLPETQGLPLPDTIQDLESQKSTAAQGNRQE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC22A11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SLC22A11 and was validated on Western blot.
Theoretical MW
60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC22A11 Antibody

  • hOAT4
  • MGC34282
  • OAT4solute carrier family 22 (organic anion/cation transporter), member 11
  • Organic anion transporter 4
  • solute carrier family 22 (organic anion/urate transporter), member 11
  • solute carrier family 22 member 11

Background

SLC22A11 is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. SLC22A11 is an integral membrane protein and is found mainly in the kidney and in the placenta, where it may act to prevent potentially harmful organic anions from reaching the fetus.The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and is found mainly in the kidney and in the placenta, where it may act to prevent potentially harmful organic anions from reaching the fetus. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00009356-M05
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-92396
Species: Hu
Applications: IHC, IHC-P
NBP1-62660
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-42202
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
H00116085-M02
Species: Hu
Applications: WB, ELISA
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-05754
Species: Hu
NBP1-32390
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-42349
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-59811
Species: Hu
Applications: WB, ICC/IF, IHC
NBP1-51684
Species: Hu
Applications: WB, ELISA, Flow
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP2-56965
Species: Hu
Applications: WB, ICC/IF
NBP1-89417
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP1-76670
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NB400-149
Species: Hu, Mu, Bv, Rt(-)
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-74482
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-57222
Species: Hu
Applications: ICC/IF

Publications for SLC22A11 Antibody (NBP1-69536) (0)

There are no publications for SLC22A11 Antibody (NBP1-69536).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC22A11 Antibody (NBP1-69536) (0)

There are no reviews for SLC22A11 Antibody (NBP1-69536). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC22A11 Antibody (NBP1-69536) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC22A11 Products

Bioinformatics Tool for SLC22A11 Antibody (NBP1-69536)

Discover related pathways, diseases and genes to SLC22A11 Antibody (NBP1-69536). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC22A11 Antibody (NBP1-69536)

Discover more about diseases related to SLC22A11 Antibody (NBP1-69536).
 

Pathways for SLC22A11 Antibody (NBP1-69536)

View related products by pathway.

PTMs for SLC22A11 Antibody (NBP1-69536)

Learn more about PTMs related to SLC22A11 Antibody (NBP1-69536).

Blogs on SLC22A11

There are no specific blogs for SLC22A11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC22A11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC22A11
Uniprot