NHE3/SLC9A3 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit NHE3/SLC9A3 Antibody - BSA Free (NBP1-82574) is a polyclonal antibody validated for use in IHC, WB, Flow and ICC/IF. Anti-NHE3/SLC9A3 Antibody: Cited in 29 publications. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: DNPVFSPDEALDRSLLARLPPWLSPGETVVPSQRARTQIPYSPGTFCRLMPFRLSSKSVDSFLQADGPEERPPAALPEST |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SLC9A3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence Reported in scientific literature (PMID: 32502894).
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Frozen Reported in scientific literature (PMID 26677983)
- Immunohistochemistry-Paraffin 1:200 - 1:500
- SDS-Page Reported in scientific literature (PMID: 32738496).
- Western Blot Reported in scientific literature (PMID: 32738496).
|
| Application Notes |
IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
| Publications |
Read Publications using NBP1-82574 in the following applications:
|
|
Reactivity Notes
Mouse reactivity reported in scientific literature (PMID: 29196502). Porcine reactivity reported in scientific literature (PMID: 32738496).
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for NHE3/SLC9A3 Antibody - BSA Free
Background
NHE3 is a member of the Sodium/Hydrogen exchanger family that plays a crucial role in acid-base and volume homeostasis by mediating the majority of sodium and bicarbonate reabsorption in the proximal tubule of the kidney. Two PKA consensus sites have been discovered in rat NHE3, serine 552 and serine 605. Research suggests that dopamine-induced phosphorylation of these consensus sites inhibit NHE3.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu
Applications: IHC, IP, WB
Species: Ca, Hu, Mu, Rt
Applications: EM, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC-WhMt, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC-WhMt, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IHC, PAGE
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NHE3/SLC9A3 Antibody (NBP1-82574). (Showing 1 - 1 of 1 FAQs).
-
The molecular weight of NHE3 is 92kDa but I see a band above 100 kDa. I am confused, because the size of these protein should not be greater than 100KD. Can you please help explain?
- Higher than predicted molecular weight seen on WB is not uncommon if the protein is posttranslationally modified, especially glycosylated, and such is the case for NHE3. Please note that NHE3 gets phosphorylated and glycosylated (Uniprot ID P48764) and potentially, these modifications are adding ~10kDa extra to the predicted molecular weight. If you want to confirm it 100%, you could try de-glycosylating your protein and then performing a WB on it.
Secondary Antibodies
| |
Isotype Controls
|
Additional NHE3/SLC9A3 Products
Research Areas for NHE3/SLC9A3 Antibody (NBP1-82574)
Find related products by research area.
|
Blogs on NHE3/SLC9A3