NHE3/SLC9A3 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574] - Analysis in human colon and liver tissues using NBP1-82574 antibody. Corresponding SLC9A3 RNA-seq data are presented for ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574] - Staining of human colon, kidney, liver and small intestine using Anti-SLC9A3 antibody NBP1-82574 (A) shows similar ...read more
Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574] - Staining of human liver shows no membranous positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574] - Staining of human colon shows strong positivity in apical membrane in glandular cells.
Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574] - Staining of human gallbladder shows strong positivity in apical membrane in glandular cells.
Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574] - Staining of human kidney shows weak positivity in apical membrane in cells in tubules.
Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574] - Staining of human small intestine shows strong positivity in apical membrane in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, PoSpecies Glossary
Applications WB, ICC/IF, IHC, PAGE
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NHE3/SLC9A3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DNPVFSPDEALDRSLLARLPPWLSPGETVVPSQRARTQIPYSPGTFCRLMPFRLSSKSVDSFLQADGPEERPPAALPEST
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC9A3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence -Reported in scientific literature (PMID: 32502894).
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Frozen -Reported in scientific literature (PMID 26677983)
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • SDS-Page -Reported in scientific literature (PMID: 32738496).
  • Western Blot -Reported in scientific literature (PMID: 32738496).
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NHE3/SLC9A3 Protein (NBP1-82574PEP)
Publications
Read Publications using
NBP1-82574 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 29196502). Use in Porcine reported in scientific publication (PMID: 32738496).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NHE3/SLC9A3 Antibody

  • isoform 3
  • MGC126718
  • NHE3
  • NHE3MGC126720
  • SLC9A3
  • solute carrier family 9 (sodium/hydrogen exchanger), member 3
  • Solute carrier family 9 member 3

Background

NHE3 is a member of the Sodium/Hydrogen exchanger family that plays a crucial role in acid-base and volume homeostasis by mediating the majority of sodium and bicarbonate reabsorption in the proximal tubule of the kidney. Two PKA consensus sites have been discovered in rat NHE3, serine 552 and serine 605. Research suggests that dopamine-induced phosphorylation of these consensus sites inhibit NHE3.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NHE3/SLC9A3 Antibody (NBP1-82574)(28)

We have publications tested in 3 confirmed species: Human, Mouse, Porcine.

We have publications tested in 8 applications: B/N, FLOW, ICC/IF, IF/IHC, IHC-Fr, IHC-P, SDS-Page, WB.


Filter By Application
B/N
(1)
FLOW
(1)
ICC/IF
(7)
IF/IHC
(3)
IHC-Fr
(1)
IHC-P
(3)
SDS-Page
(1)
WB
(6)
All Applications
Filter By Species
Human
(10)
Mouse
(7)
Porcine
(1)
All Species
Showing Publications 1 - 10 of 28. Show All 28 Publications.
Publications using NBP1-82574 Applications Species
Kim YH, Lee YK, Park SS et al. Mid-old cells are a potential target for anti-aging interventions in the elderly Nature communications 2023-11-22 [PMID: 37993434] (IHC-P, Mouse, Human) IHC-P Mouse, Human
Mödl B, Awad M, Zwolanek D et al. Defects in microvillus crosslinking sensitize to colitis and inflammatory bowel disease EMBO reports 2023-09-11 [PMID: 37691494] (WB, ICC/IF, Mouse) WB, ICC/IF Mouse
Zachos NC, Vaughan H, Sarker R et al. A NOVEL PEPTIDE PREVENTS ENTEROTOXIN- AND INFLAMMATION-INDUCED INTESTINAL FLUID SECRETION BY STIMULATING NHE3 ACTIVITY Gastroenterology 2023-07-08 [PMID: 37429363]
Peritore-Galve FC, Kaji I, Smith A et al. Increased intestinal permeability and downregulation of absorptive ion transporters Nhe3, Dra, and Sglt1 contribute to diarrhea during Clostridioides difficile infection Gut microbes 2023-06-23 [PMID: 37350393] (IHC-P, Mouse) IHC-P Mouse
Salari A, Zhou K, Nikolovska K et al. Human Colonoid-Myofibroblast Coculture for Study of Apical Na+/H+ Exchangers of the Lower Cryptal Neck Region International journal of molecular sciences 2023-02-21 [PMID: 36901695] (WB, ICC/IF, Human) WB, ICC/IF Human
Hiltz RL, McCurdy DE, Moreland S et al. Effects of weaning on regulators of volatile fatty acid absorption and intracellular pH in Holstein calves JDS Communications 2021-11-01 [PMID: 36337096] (ICC/IF) ICC/IF
Donowitz M, Sarker R, Lin R et al. Identification of Intestinal NaCl Absorptive-Anion Secretory Cells: Potential Functional Significance Frontiers in Physiology 2022-07-19 [PMID: 35928564] (B/N) B/N
Duclaux-Loras R, Lebreton C, Berthelet J et al. UNC45A deficiency causes microvillus inclusion disease-like phenotype by impairing myosin VB-dependent apical trafficking The Journal of clinical investigation 2022-05-16 [PMID: 35575086] (IF/IHC, ICC/IF, Human) IF/IHC, ICC/IF Human
Haynes J, Palaniappan B, Tsopmegha E, Sundaram U Regulation of nutrient and electrolyte absorption in human organoid-derived intestinal epithelial cell monolayers Translational Research 2022-05-01 [PMID: 35513245]
Yanda MK, Cebotaru L VX-809 mitigates disease in a mouse model of autosomal dominant polycystic kidney disease bearing the R3277C human mutation FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2021-11-01 [PMID: 34662459]
Show All 28 Publications.

Reviews for NHE3/SLC9A3 Antibody (NBP1-82574) (0)

There are no reviews for NHE3/SLC9A3 Antibody (NBP1-82574). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NHE3/SLC9A3 Antibody (NBP1-82574). (Showing 1 - 1 of 1 FAQs).

  1. The molecular weight of NHE3 is 92kDa but I see a band above 100 kDa.  I am confused, because the size of these protein should not be greater than 100KD. Can you please help explain?  
    • Higher than predicted molecular weight seen on WB is not uncommon if the protein is posttranslationally modified, especially glycosylated, and such is the case for NHE3. Please note that NHE3 gets phosphorylated and glycosylated (Uniprot ID P48764) and potentially, these modifications are adding ~10kDa extra to the predicted molecular weight. If you want to confirm it 100%, you could try de-glycosylating your protein and then performing a WB on it. 

Secondary Antibodies

 

Isotype Controls

Additional NHE3/SLC9A3 Products

Research Areas for NHE3/SLC9A3 Antibody (NBP1-82574)

Find related products by research area.

Blogs on NHE3/SLC9A3

There are no specific blogs for NHE3/SLC9A3, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NHE3/SLC9A3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC9A3