OCTN1/SLC22A4 Antibody

Images

 
Western Blot: OCTN1/SLC22A4 Antibody [H00006583-A01] - Analysis of SLC22A4 expression in Daoy.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, IHC-FrFl, IHC-WhMt
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

OCTN1/SLC22A4 Antibody Summary

Immunogen
SLC22A4 (NP_003050, 43 a.a. - 141 a.a.) partial recombinant protein with GST tag. AGTPEHRCRVPDAANLSSAWRNNSVPLRLRDGREVPHSCSRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFSQDVYLSTVVTEWNLVCEDNWK
Specificity
solute carrier family 22 (organic cation transporter), member 4
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
SLC22A4
Purity
Unpurified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry Free-Floating
  • Immunohistochemistry Whole-Mount
Application Notes
Antibody reactivity against Mouse cell lysate and tissue for WB reported from review. It has been used for ELISA. IHC-FF and IHC-WM usages reported in scientific literature (PMID: 27023905).
Reviewed Applications
Read 1 Review rated 4
using
H00006583-A01 in the following applications:

Publications
Read Publications using
H00006583-A01 in the following applications:

Reactivity Notes

Mouse reactivity reported from customer review. Rat reactivity reported in scientific literature (PMID: 27023905). Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
Whole antisera with 50% Glycerol
Preservative
No Preservative
Purity
Unpurified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for OCTN1/SLC22A4 Antibody

  • Ergothioneine transporter
  • ET transporter
  • ETT
  • MGC34546
  • MGC40524
  • OCTN1
  • OCTN1integral membrane transport protein
  • Organic cation/carnitine transporter 1
  • SLC22A4
  • solute carrier family 22 (organic cation/ergothioneine transporter), member 4
  • solute carrier family 22 member 4
  • UT2H

Background

Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. The encoded protein is an organic cation transporter and plasma integral membrane protein containing eleven putative transmembrane domains as well as a nucleotide-binding site motif. Transport by this protein is at least partially ATP-dependent.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-65203
Species: Hu
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-51684
Species: Hu, Mu
Applications: WB, EM, ELISA, Flow, IHC
NBP1-89417
Species: Hu, Rt
Applications: WB, IHC, IHC-P, Single Cell Western
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-28739
Species: Hu
Applications: WB, IP
NBP1-69368
Species: Hu
Applications: WB, IHC, IHC-P
NB110-40730
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
H00005452-D01P
Species: Hu, Mu, Rt
Applications: WB
NB600-1147
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, IHC-P, Flow-CS
AF7895
Species: Hu
Applications: WB, IHC
NB100-80870
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85467
Species: Hu
Applications: WB, IHC, IHC-P
NB110-60928
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, EM, IHC, IHC-P

Publications for OCTN1/SLC22A4 Antibody (H00006583-A01)(2)

Review for OCTN1/SLC22A4 Antibody (H00006583-A01) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using H00006583-A01:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot OCTN1/SLC22A4 H00006583-A01
Enlarge
reviewed by:
Adam David
WB Mouse 07/02/2014
View

Summary

ApplicationWestern Blot
Sample Testedmouse liver
SpeciesMouse

Blocking

Blocking Details5 % Milk 1h RT

Primary Anitbody

Dilution Ratio1:200

Secondary Antibody

Secondary DescriptionGoat anti-mouse IgG, HRP
Secondary Concentration1:10,000

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OCTN1/SLC22A4 Antibody (H00006583-A01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for OCTN1/SLC22A4 Antibody (H00006583-A01)

Discover related pathways, diseases and genes to OCTN1/SLC22A4 Antibody (H00006583-A01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OCTN1/SLC22A4 Antibody (H00006583-A01)

Discover more about diseases related to OCTN1/SLC22A4 Antibody (H00006583-A01).
 

Pathways for OCTN1/SLC22A4 Antibody (H00006583-A01)

View related products by pathway.

PTMs for OCTN1/SLC22A4 Antibody (H00006583-A01)

Learn more about PTMs related to OCTN1/SLC22A4 Antibody (H00006583-A01).

Blogs on OCTN1/SLC22A4

There are no specific blogs for OCTN1/SLC22A4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Adam David
07/02/2014
Application: WB
Species: Mouse

Bioinformatics

Gene Symbol SLC22A4
Entrez
OMIM
Uniprot