SLC22A12 Antibody (2B5)

Western Blot: SLC22A12 Antibody (2B5) [H00116085-M02] - SLC22A12 monoclonal antibody (M02), clone 2B5. Analysis of SLC22A12 expression in human stomach.

ELISA: SLC22A12 Antibody (2B5) [H00116085-M02] - Detection limit for recombinant GST tagged SLC22A12 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clone: 2B5
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

SLC22A12 Antibody (2B5) Summary

• Immunogen: SLC22A12 (NP_653186.2, 281 a.a. ~ 349 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ESARWLLTTGRLDWGLQELWRVAAINGKGAVQDTLTPEVLLSAMREELSMGQPPASLGTLLRMPGLRFR
• Specificity: SLC22A12 - solute carrier family 22 (organic anion/cation transporter), member 12 (2B5)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SLC22A12
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SLC22A12 Antibody (2B5)

• OATL4
• Organic anion transporter 4-like protein
• Renal-specific transporter
• RST
• RSTmember 12
• SLC22A12
• solute carrier family 22 (organic anion/urate transporter), member 12
• UNQ6453/PRO34004
• URAT1
• URAT1Urate anion exchanger 1
• urate transporter 1

Background

The protein encoded by this gene is a urate transporter and urate-anion exchanger which regulates the level of urate in the blood. This protein is an integral membrane protein primarily found in kidney. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SLC22A12 Antibody (H00116085-M02)(4)

Publications using H00116085-M02

• Feng Y, Lin S, Zhao X et al. Taurine Inhibited Uric Acid Uptake in HK-2 Renal Tubular Epithelial Cells. Adv Exp Med Biol. 2019-08-30 [PMID: 31468393]
• Mannino GC, Fuoco A, Marini MA et al. The polymorphism rs35767 at IGF1 locus is associated with serum urate levels Sci Rep 2018-08-16 [PMID: 30115944]
• Yan B, Zhang ZZ, Huang LY et al. OIT3 deficiency impairs uric acid reabsorption in renal tubule. FEBS Lett. 2012-01-28 [PMID: 22306318]
• Roncal-Jimenez CA, Lanaspa MA, Rivard CJ et al. Sucrose induces fatty liver and pancreatic inflammation in male breeder rats independent of excess energy intake. Metabolism. 2011-04-11 [PMID: 21489572]

Bioinformatics

• Gene Symbol: SLC22A12
• Entrez:
  • 116085(Human)
• Uniprot:
  • NP_653186(Human)