SLC22A12 Antibody (2B5)

Images

 
Western Blot: SLC22A12 Antibody (2B5) [H00116085-M02] - SLC22A12 monoclonal antibody (M02), clone 2B5. Analysis of SLC22A12 expression in human stomach.
ELISA: SLC22A12 Antibody (2B5) [H00116085-M02] - Detection limit for recombinant GST tagged SLC22A12 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, S-ELISA
Clone
2B5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SLC22A12 Antibody (2B5) Summary

Immunogen
SLC22A12 (NP_653186.2, 281 a.a. ~ 349 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ESARWLLTTGRLDWGLQELWRVAAINGKGAVQDTLTPEVLLSAMREELSMGQPPASLGTLLRMPGLRFR
Specificity
SLC22A12 - solute carrier family 22 (organic anion/cation transporter), member 12 (2B5)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SLC22A12
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Sandwich ELISA
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Publications
Read Publications using H00116085-M02.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SLC22A12 Antibody (2B5)

  • OATL4
  • Organic anion transporter 4-like protein
  • Renal-specific transporter
  • RSTmember 12
  • solute carrier family 22 (organic anion/urate transporter), member 12
  • URAT1
  • URAT1Urate anion exchanger 1
  • urate transporter 1

Background

The protein encoded by this gene is a urate transporter and urate-anion exchanger which regulates the level of urate in the blood. This protein is an integral membrane protein primarily found in kidney. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-05054
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00009356-M05
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP1-88267
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-69536
Species: Hu
Applications: WB
NBP1-47987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-42202
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
H00009376-B01P
Species: Hu, Rt
Applications: WB, IHC
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-50321
Species: Hu, Ca
Applications: IHC, IHC-Fr, IHC-P, IF
MAB8398
Species: Hu
Applications: Flow, CyTOF-ready
NB600-934
Species: Ba
Applications: WB, ELISA, IP
NBP2-75717
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-83239
Species: Hu, Bv
Applications: WB, IHC, IHC-P
NBP1-62660
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-93859
Species: Hu, Mu, Rt
Applications: WB, IHC
H00006583-A01
Species: Hu, Mu, Rt, Ca
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-WhMt
NBP1-89680
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, ChIP
H00116085-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA

Publications for SLC22A12 Antibody (H00116085-M02)(3)

Reviews for SLC22A12 Antibody (H00116085-M02) (0)

There are no reviews for SLC22A12 Antibody (H00116085-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SLC22A12 Antibody (H00116085-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SLC22A12 Products

Bioinformatics Tool for SLC22A12 Antibody (H00116085-M02)

Discover related pathways, diseases and genes to SLC22A12 Antibody (H00116085-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC22A12 Antibody (H00116085-M02)

Discover more about diseases related to SLC22A12 Antibody (H00116085-M02).
 

Pathways for SLC22A12 Antibody (H00116085-M02)

View related products by pathway.

PTMs for SLC22A12 Antibody (H00116085-M02)

Learn more about PTMs related to SLC22A12 Antibody (H00116085-M02).

Blogs on SLC22A12

There are no specific blogs for SLC22A12, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC22A12 Antibody (2B5) and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC22A12
Entrez
Uniprot