NHERF-2 Antibody - BSA Free

Immunohistochemistry-Paraffin: NHERF-2 Antibody [NBP2-62651] - Analysis in human spleen and tonsil tissues using Anti-SLC9A3R2 antibody. Corresponding SLC9A3R2 RNA-seq data are presented for the same tissues.

Western Blot: NHERF-2 Antibody [NBP2-62651] - Analysis in human cell line RT-4 and human cell line U-251 MG.

Immunohistochemistry-Paraffin: NHERF-2 Antibody [NBP2-62651] - Staining of human tonsil shows low expression as expected.

Immunohistochemistry-Paraffin: NHERF-2 Antibody [NBP2-62651] - Staining of human spleen shows high expression.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NHERF-2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ETDEHFKRLRVTPTEEHVEGPLPSPVTNGTSPAQLNGGSACSSRSDLPGSD
• Predicted Species: Mouse (94%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC9A3R2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  NHERF-2 Recombinant Protein Antigen (NBP2-62651PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for NHERF-2 Antibody - BSA Free

• E3KARP
• Na(+)/H(+) exchange regulatory cofactor NHE-RF2
• NHE3RF2
• NHERF2MGC104639
• NHERF-2NHE3 kinase A regulatory protein E3KARP
• OCTS2
• SIP-1SRY-interacting protein 1
• sodium/hydrogen exchanger
• Sodium-hydrogen exchanger regulatory factor 2
• solute carrier family 9 (sodium/hydrogen exchanger), isoform 3 regulator 2
• solute carrier family 9 (sodium/hydrogen exchanger), isoform 3 regulatoryfactor 2
• solute carrier family 9 (sodium/hydrogen exchanger), member 3 regulator 2
• Solute carrier family 9 isoform A3 regulatory factor 2
• TKA-1SIP1
• Tyrosine kinase activator protein 1

Background

NHERF-2 is a scaffold protein that connects plasma membrane proteins with members of the ezrin/moesin/radixin family and thereby helps to link them to the actin cytoskeleton and to regulate their surface expression. Necessary for cAMP-mediated phosphorylation and inhibition of SLC9A3. May also act as scaffold protein in the nucleus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC9A3R2