| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, IHC, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit SLC26A3 Antibody - BSA Free (NBP1-84450) is a polyclonal antibody validated for use in IHC and WB. Anti-SLC26A3 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DQPINTTDLPFHIDWNDDLPLNIEVPKISLHSLILDFSAVSFLDVSSVRGLKSILQEFIRIKVDVYIVGTDDDFIEKLNRYEFFDGEVKSSIFFLTIHDAVLHILMKKDYSTSKFNP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC26A3 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for SLC26A3 Antibody (NBP1-84450)Find related products by research area.
|
|
Next-Gen DNA Sequencing and SLC26A3 Research The SLC26A3, also known as DRA (downregulated-in-adenoma) gene is a member of the sulphate anion transporter family, serving an important role in the exchange and transport of chloride, bicarbonate and sulphate ions at plasma membrane sites. We at Nov... Read full blog post. |
|
Antibody Therapies and the New Generation of DNA Sequencing Our antibody database is primarily focused on protein-coding genes. Although they form only 1% of the total human genome, these important genes account for 85% of the mutations that lead to disease.DNA sequencing (defining the sequence of the 4 base... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SLC26A3 |