PBR Antibody (4I9K6)

Western Blot: PBR Antibody (4I9K6) [NBP3-16497] - Western blot analysis of extracts of various cell lines, using PBR Rabbit mAb (NBP3-16497) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Immunohistochemistry: PBR Antibody (4I9K6) [NBP3-16497] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney tissue using PBR Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: PBR Antibody (4I9K6) [NBP3-16497] - Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using PBR Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: PBR Antibody (4I9K6) [NBP3-16497] - Confocal imaging of U-2 OS cells using PBR Rabbit mAb. The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

Immunocytochemistry/ Immunofluorescence: PBR Antibody (4I9K6) [NBP3-16497] - Confocal imaging of NIH/3T3 cells using PBR Rabbit mAb. The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

Immunohistochemistry: PBR Antibody (4I9K6) [NBP3-16497] - Immunohistochemistry analysis of paraffin-embedded Human liver tissue using PBR Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: PBR Antibody (4I9K6) [NBP3-16497] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using PBR Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: PBR Antibody (4I9K6) [NBP3-16497] - Immunohistochemistry analysis of paraffin-embedded Human lung cancer tissue using PBR Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: PBR Antibody (4I9K6) [NBP3-16497] - Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using PBR Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC
• Clone: 4I9K6
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

PBR Antibody (4I9K6) Summary

• Description: Novus Biologicals Rabbit PBR Antibody (4I9K6) (NBP3-16497) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 70-169 of human PBR (P30536). ELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNHGWRGGRRLPE
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: TSPO
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PBR Antibody (4I9K6)

• benzodiazepine peripheral binding site
• BZRPDBI
• IBP
• MBRPBS
• mDRC
• Mitochondrial benzodiazepine receptor
• PBR
• PBRBPBS
• PBRS
• peripheral benzodiazepine receptor
• Peripheral-type benzodiazepine receptor
• pk18
• PKBSbenzodiazapine receptor (peripheral)
• PTBR
• translocator protein (18kDa)
• translocator protein
• TSPO

Background

Present mainly in the mitochondrial compartment of peripheral tissues, the protein encoded by this gene interacts with some benzodiazepines and has different affinities than its endogenous counterpart. The protein is a key factor in the flow of cholesterol into mitochondria to permit the initiation of steroid hormone synthesis. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TSPO