CD77 Synthase Antibody

Images

 
Western Blot: CD77 Synthase Antibody [NBP1-62583] - THP-1 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CD77 Synthase Antibody Summary

Immunogen
Synthetic peptides corresponding to A4GALT(alpha 1,4-galactosyltransferase (globotriaosylceramide synthase)) The peptide sequence was selected from the middle region of A4GALT (NP_059132). Peptide sequence RIALMWKFGGIYLDTDFIVLKNLRNLTNVLGTQSRYVLNGAFLAF
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
A4GALT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against A4GALT and was validated on Western blot.
Theoretical MW
40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using NBP1-62583.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CD77 Synthase Antibody

  • A14GALTalpha 1,4-galactosyltransferase (globotriaosylceramide synthase, P blood group)
  • A4GALT1
  • alpha 1,4-galactosyltransferase
  • Alpha-1,4-galactosyltransferase
  • alpha-1,4-N-acetylglucosaminyltransferase
  • alpha4Gal-T1
  • CD77 synthase
  • EC 2.4.1.228
  • Gb3 synthase
  • Gb3S
  • Globotriaosylceramide synthase
  • lactosylceramide 4-alpha-galactosyltransferase
  • P blood group (P one antigen)
  • P(k) antigen synthase
  • P(k)
  • P1
  • P1/Pk synthase
  • PK
  • UDP-galactose:beta-D-galactosyl-beta1-R 4-alpha-D-galactosyltransferase

Background

The protein encoded by this gene catalyzes the transfer of galactose to lactosylceramide to form globotriaosylceramide, which has been identified as the P(k) antigen of the P blood group system. The encoded protein, which is a type II membrane protein fou

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
AF5866
Species: Hu
Applications: WB, IHC
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
H00000518-R01
Species: Hu
NBP1-81134
Species: Hu
Applications: IHC, IHC-P
NBP1-71702
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82859
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85965
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57999
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IP
NBP1-86784
Species: Hu
Applications: IHC, IHC-P
NBP1-92355
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB600-326
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-62583
Species: Hu
Applications: WB

Publications for CD77 Synthase Antibody (NBP1-62583)(1)


Showing Publication 1 - 1 of 1.
Publication using NBP1-62583 Applications Species
Hellberg,A. Transfusion 48 (3), 479-487. 2008 [PMID: 18067504]

Reviews for CD77 Synthase Antibody (NBP1-62583) (0)

There are no reviews for CD77 Synthase Antibody (NBP1-62583). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD77 Synthase Antibody (NBP1-62583) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CD77 Synthase Products

Bioinformatics Tool for CD77 Synthase Antibody (NBP1-62583)

Discover related pathways, diseases and genes to CD77 Synthase Antibody (NBP1-62583). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD77 Synthase Antibody (NBP1-62583)

Discover more about diseases related to CD77 Synthase Antibody (NBP1-62583).

Blogs on CD77 Synthase

There are no specific blogs for CD77 Synthase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD77 Synthase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol A4GALT
Entrez
Uniprot