ZAK Antibody (3G5)

Images

 
Western Blot: ZAK Antibody (3G5) [H00051776-M03] - ZAK monoclonal antibody (M03), clone 3G5. Western Blot analysis of ZAK expression in human stomach.
Immunocytochemistry/ Immunofluorescence: ZAK Antibody (3G5) [H00051776-M03] - Analysis of monoclonal antibody to ZAK on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: ZAK Antibody (3G5) [H00051776-M03] - Analysis of monoclonal antibody to ZAK on formalin-fixed paraffin-embedded human prostate. Antibody concentration 3 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P
Clone
3G5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ZAK Antibody (3G5) Summary

Immunogen
ZAK (AAH01401, 1 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MSSLGASFVQIKFDDLQFFENCGGGSFGSVYRAKWISQDKEVAVKKLLKIEKEAEILSVLSHRNIIQFYGVILEPPNYGIVTEYASLGSLYDYINSNRSEEMDMDHIMTWATDVAKGMHY
Specificity
ZAK - sterile alpha motif and leucine zipper containing kinase AZK
Isotype
IgG3 Lambda
Clonality
Monoclonal
Host
Mouse
Gene
ZAK
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. Has also been used for immunohistochemistry (paraffin).
Control
ZAK Knockout HeLa Cell Lysate
Publications
Read Publications using H00051776-M03.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZAK Antibody (3G5)

  • AZK
  • EC 2.7.11
  • EC 2.7.11.25
  • HCCS-4
  • Human cervical cancer suppressor gene 4 protein
  • Leucine zipper- and sterile alpha motif-containing kinase
  • mitogen-activated protein kinase kinase kinase MLT
  • mixed lineage kinase 7
  • mixed lineage kinase with a leucine zipper and a sterile alpha motif
  • mixed lineage kinase-related kinase MRK-beta
  • Mixed lineage kinase-related kinase
  • MLK7
  • mlklak
  • MLK-like mitogen-activated protein triple kinase
  • MLK-related kinase
  • MLT
  • MLTK
  • MRKcervical cancer suppressor gene 4 protein
  • pk
  • protein kinase
  • sterile alpha motif and leucine zipper containing kinase AZK
  • Sterile alpha motif- and leucine zipper-containing kinase AZK

Background

This gene is a member of the MAPKKK family of signal transduction molecules and encodes a protein with an N-terminal kinase catalytic domain, followed by a leucine zipper motif and a sterile-alpha motif (SAM). This magnesium-binding protein forms homodimers and is located in the cytoplasm. The protein mediates gamma radiation signaling leading to cell cycle arrest and activity of this protein plays a role in cell cycle checkpoint regulation in cells. The protein also has pro-apoptotic activity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-41398
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-67569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NB100-236
Species: Hu, Mu
Applications: WB, IB, IHC, IHC-Fr, IP
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, PA, B/N, KD
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89993
Species: Hu
Applications: WB, IHC, IHC-P
AF2498
Species: Mu
Applications: WB, IP
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58327
Species: Hu
Applications: WB, ICC/IF
NBP1-89781
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-88262
Species: Hu
Applications: WB, IHC, IHC-P
H00079092-P01
Species: Hu
MAB3428
Species: Hu
Applications: WB, IHC
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP

Publications for ZAK Antibody (H00051776-M03)(3)

Reviews for ZAK Antibody (H00051776-M03) (0)

There are no reviews for ZAK Antibody (H00051776-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZAK Antibody (H00051776-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ZAK Products

Bioinformatics Tool for ZAK Antibody (H00051776-M03)

Discover related pathways, diseases and genes to ZAK Antibody (H00051776-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZAK Antibody (H00051776-M03)

Discover more about diseases related to ZAK Antibody (H00051776-M03).
 

Pathways for ZAK Antibody (H00051776-M03)

View related products by pathway.

PTMs for ZAK Antibody (H00051776-M03)

Learn more about PTMs related to ZAK Antibody (H00051776-M03).
 

Research Areas for ZAK Antibody (H00051776-M03)

Find related products by research area.

Blogs on ZAK

There are no specific blogs for ZAK, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZAK Antibody (3G5) and receive a gift card or discount.

Bioinformatics

Gene Symbol ZAK
Entrez
OMIM
Uniprot