PADI2 Antibody

Images

 
Western Blot: PADI2 Antibody [NBP1-54958] - Jurkat cell lysate, concentration 0.2-1 ug/ml.
Western Blot: PADI2 Antibody [NBP1-54958] - Hela Whole cell lysates, Antibody Dilution: 1.0 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PADI2 Antibody Summary

Immunogen
Synthetic peptides corresponding to PADI2(peptidyl arginine deiminase, type II) The peptide sequence was selected from the middle region of PADI2. Peptide sequence RGDRWIQDEIEFGYIEAPHKGFPVVLDSPRDGNLKDFPVKELLGPDFGYV.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PADI2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against PADI2 and was validated on Western blot.
Theoretical MW
75 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PADI2 Antibody

  • EC 3.5.3.15
  • KIAA0994PDI2PAD2
  • PAD2
  • PAD-H19
  • PADI2
  • PDI2
  • peptidlyarginine deiminase type II
  • peptidyl arginine deiminase, type II
  • Peptidylarginine Deiminase II
  • protein arginine deiminase
  • Protein-arginine deiminase type II
  • protein-arginine deiminase type-2

Background

PADI2 encodes a member of the peptidyl arginine deiminase family of enzymes, which catalyze the post-translational deimination of proteins by converting arginine residues into citrullines in the presence of calcium ions. The family members have distinct substrate specificities and tissue-specific expression patterns. The type II enzyme is the most widely expressed family member. Known substrates for this enzyme include myelin basic protein in the central nervous system and vimentin in skeletal muscle and macrophages. PADI2 is thought to play a role in the onset and progression of neurodegenerative human disorders, including Alzheimer disease and multiple sclerosis, and it has also been implicated in glaucoma pathogenesis.This gene encodes a member of the peptidyl arginine deiminase family of enzymes, which catalyze the post-translational deimination of proteins by converting arginine residues into citrullines in the presence of calcium ions. The family members have distinct substrate specificities and tissue-specific expression patterns. The type II enzyme is the most widely expressed family member. Known substrates for this enzyme include myelin basic protein in the central nervous system and vimentin in skeletal muscle and macrophages. This enzyme is thought to play a role in the onset and progression of neurodegenerative human disorders, including Alzheimer disease and multiple sclerosis, and it has also been implicated in glaucoma pathogenesis. This gene exists in a cluster with four other paralogous genes. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02082
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-91834
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37761
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80956
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92240
Species: Hu
Applications: WB, IHC, IHC-P
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-22568
Species: Hu
Applications: IHC-P
NBP1-87527
Species: Hu
Applications: IHC, IHC-P
NBP1-88573
Species: Hu
Applications: WB, IHC, IHC-P
H00004340-B01P
Species: Hu, Rt
Applications: WB
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
H00002729-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-13075
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP1-31333
Species: Hu, Rt, Rb
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67074
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-54958
Species: Hu
Applications: WB

Publications for PADI2 Antibody (NBP1-54958) (0)

There are no publications for PADI2 Antibody (NBP1-54958).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PADI2 Antibody (NBP1-54958) (0)

There are no reviews for PADI2 Antibody (NBP1-54958). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PADI2 Antibody (NBP1-54958) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PADI2 Antibody (NBP1-54958)

Discover related pathways, diseases and genes to PADI2 Antibody (NBP1-54958). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PADI2 Antibody (NBP1-54958)

Discover more about diseases related to PADI2 Antibody (NBP1-54958).
 

Pathways for PADI2 Antibody (NBP1-54958)

View related products by pathway.

PTMs for PADI2 Antibody (NBP1-54958)

Learn more about PTMs related to PADI2 Antibody (NBP1-54958).

Blogs on PADI2

There are no specific blogs for PADI2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PADI2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PADI2
Entrez
Uniprot