Filaggrin Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Filaggrin Antibody [NBP1-87528] - Immunofluorescent staining of human cell line HaCaT shows localization to vesicles.
Immunohistochemistry-Paraffin: Filaggrin Antibody [NBP1-87528] - Staining of human skin shows strong positivity in epidermal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Filaggrin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RKRLSERLEEKEDNEEGVYDYENTGRMTQKWIQSGHIATYYTIQDEAYDTTDSLLEENKIYERSRSSDGKSSSQVNRSRHENTSQVPLQESR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FLG
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Filaggrin Protein (NBP1-87528PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Filaggrin Antibody

  • ATOD2
  • epidermal filaggrin
  • filaggrin
  • Profilaggrin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2727
Species: Hu, Po, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-33610
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32962
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NB100-2756
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-00932
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-1287
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
NBP2-34270
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-45538
Species: Hu
Applications: WB, IHC, IHC-P
232-FA/CF
Species: Hu
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB110-56916
Species: Hu
Applications: Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87528
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Filaggrin Antibody (NBP1-87528) (0)

There are no publications for Filaggrin Antibody (NBP1-87528).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Filaggrin Antibody (NBP1-87528) (0)

There are no reviews for Filaggrin Antibody (NBP1-87528). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Filaggrin Antibody (NBP1-87528) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Filaggrin Products

Bioinformatics Tool for Filaggrin Antibody (NBP1-87528)

Discover related pathways, diseases and genes to Filaggrin Antibody (NBP1-87528). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Filaggrin Antibody (NBP1-87528)

Discover more about diseases related to Filaggrin Antibody (NBP1-87528).
 

Pathways for Filaggrin Antibody (NBP1-87528)

View related products by pathway.

PTMs for Filaggrin Antibody (NBP1-87528)

Learn more about PTMs related to Filaggrin Antibody (NBP1-87528).
 

Research Areas for Filaggrin Antibody (NBP1-87528)

Find related products by research area.

Blogs on Filaggrin

There are no specific blogs for Filaggrin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Filaggrin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FLG