Filaggrin Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Filaggrin Antibody [NBP1-87528] - Analysis in human skin and liver tissues. Corresponding Filaggrin RNA-seq data are presented for the same tissues.
Independent Antibodies: Immunohistochemistry-Paraffin: Filaggrin Antibody [NBP1-87528] - Staining of human gastrointestinal, liver, skin and testis using Anti-Filaggrin antibody NBP1-87528 (A) shows similar ...read more
Immunocytochemistry/ Immunofluorescence: Filaggrin Antibody [NBP1-87528] - Staining of human cell line HaCaT shows localization to vesicles.
Immunohistochemistry-Paraffin: Filaggrin Antibody [NBP1-87528] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Filaggrin Antibody [NBP1-87528] - Staining of human kidney shows low expression as expected.
Immunohistochemistry-Paraffin: Filaggrin Antibody [NBP1-87528] - Staining of human skin shows high expression.
Immunohistochemistry-Paraffin: Filaggrin Antibody [NBP1-87528] - Staining of human gastrointestinal shows no positivity in glandular cells as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Filaggrin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RKRLSERLEEKEDNEEGVYDYENTGRMTQKWIQSGHIATYYTIQDEAYDTTDSLLEENKIYERSRSSDGKSSSQVNRSRHENTSQVPLQESR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FLG
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Filaggrin Protein (NBP1-87528PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-87528 in the following applications:

Publications
Read Publications using
NBP1-87528 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Filaggrin Antibody

  • ATOD2
  • epidermal filaggrin
  • filaggrin
  • Profilaggrin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2727
Species: Ca, Hu, Po, Pm
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-33610
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-61736
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, IHC, IHC-P, WB
233-FB
Species: Hu
Applications: BA
NBP2-29429
Species: Bv, Ca, Ch, Hu, Pm, Mu, Rb, Rt, Re, Ze
Applications: CyTOF-reported, Dual ISH-IHC, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Single-Cell Western, WB
H00002263-M01
Species: Bv, Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NB600-1287
Species: Ca, Hu, Mu, Rb, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-34270
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western
DY413
Species: Mu
Applications: ELISA
NBP2-45538
Species: Hu, Rt
Applications: IHC, IHC-P, WB
232-FA/CF
Species: Hu
Applications: BA
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
251-KG
Species: Hu
Applications: BA
AF4928
Species: Hu
Applications: CyTOF-ready, Flow, WB
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
236-EG
Species: Hu
Applications: BA
NBP2-22194
Species: Hu, Pm, Mu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB

Publications for Filaggrin Antibody (NBP1-87528)(3)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 2 applications: IHC, IHC-P.


Filter By Application
IHC
(2)
IHC-P
(1)
All Applications
Filter By Species
Human
(2)
Mouse
(1)
All Species

Review for Filaggrin Antibody (NBP1-87528) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-87528:
Filter by Applications
IHC-P
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin Filaggrin NBP1-87528
Enlarge
4
reviewed by:
Agnès Tessier
IHC-P Human 02/27/2020
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample TestedSkin tissue
SpeciesHuman
LotB107029

Comments

CommentsFilaggrin was detected in reconstructed human epidermis paraffin tissues using the anti-filaggrin antibody (1:100 dilution). Citrate was used as antigen retrieval reagent (30 min) and antibody was incubated overnight at 4°C. As expected, filaggrin was detected in the upper layers of the skin.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Filaggrin Antibody (NBP1-87528) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Filaggrin Products

Diseases for Filaggrin Antibody (NBP1-87528)

Discover more about diseases related to Filaggrin Antibody (NBP1-87528).
 

Pathways for Filaggrin Antibody (NBP1-87528)

View related products by pathway.

PTMs for Filaggrin Antibody (NBP1-87528)

Learn more about PTMs related to Filaggrin Antibody (NBP1-87528).
 

Research Areas for Filaggrin Antibody (NBP1-87528)

Find related products by research area.

Blogs on Filaggrin

There are no specific blogs for Filaggrin, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Agnès Tessier
02/27/2020
Application: IHC-P
Species: Human

Bioinformatics

Gene Symbol FLG