Filaggrin Antibody

Images

 
Immunohistochemistry-Paraffin: Filaggrin Antibody [NBP1-87528] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Filaggrin Antibody [NBP1-87528] - Staining of human kidney shows low expression as expected.
Immunohistochemistry-Paraffin: Filaggrin Antibody [NBP1-87528] - Staining of human skin shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Filaggrin Antibody [NBP1-87528] - Analysis in human skin and liver tissues. Corresponding Filaggrin RNA-seq data are presented for the same tissues.
Independent Antibodies: Immunohistochemistry-Paraffin: Filaggrin Antibody [NBP1-87528] - Staining of human gastrointestinal, liver, skin and testis using Anti-Filaggrin antibody NBP1-87528 (A) shows similar ...read more
Immunohistochemistry-Paraffin: Filaggrin Antibody [NBP1-87528] - Staining of human gastrointestinal shows no positivity in glandular cells as expected.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Filaggrin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RKRLSERLEEKEDNEEGVYDYENTGRMTQKWIQSGHIATYYTIQDEAYDTTDSLLEENKIYERSRSSDGKSSSQVNRSRHENTSQVPLQESR
Specificity
Specificity of human Filaggrin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FLG
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
ICC/IF reported in scientific literature (PMID: 29316698). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Reviewed Applications
Read 1 Review rated 4
using
NBP1-87528 in the following applications:

Publications
Read Publication using
NBP1-87528 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Mouse reactivity reported in the scientific literature (PMID: 29316698).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Filaggrin Antibody

  • ATOD2
  • epidermal filaggrin
  • filaggrin
  • Profilaggrin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2727
Species: Hu, Po, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-33610
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-61736
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP2-29429
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm, Rb, Re, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC, Flow-IC, Single Cell Western
NBP2-00932
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-1287
Species: Hu, Mu, Rt, Rb
Applications: WB, Flow, IHC, IP, CyTOF-ready
NBP2-34270
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-67559
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB49281
Species: Hu
Applications: Flow, CyTOF-ready
AF1280
Species: Mu
Applications: WB, Simple Western, IHC
NBP2-22194
Species: Hu, Mu, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-87528
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for Filaggrin Antibody (NBP1-87528)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Review for Filaggrin Antibody (NBP1-87528) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-87528:
Filter by Applications
IHC-P
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin Filaggrin NBP1-87528
Enlarge
reviewed by:
Agnès Tessier
IHC-P Human 02/27/2020
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample TestedSkin tissue
SpeciesHuman
LotB107029

Comments

CommentsFilaggrin was detected in reconstructed human epidermis paraffin tissues using the anti-filaggrin antibody (1:100 dilution). Citrate was used as antigen retrieval reagent (30 min) and antibody was incubated overnight at 4°C. As expected, filaggrin was detected in the upper layers of the skin.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Filaggrin Antibody (NBP1-87528) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Filaggrin Products

Bioinformatics Tool for Filaggrin Antibody (NBP1-87528)

Discover related pathways, diseases and genes to Filaggrin Antibody (NBP1-87528). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Filaggrin Antibody (NBP1-87528)

Discover more about diseases related to Filaggrin Antibody (NBP1-87528).
 

Pathways for Filaggrin Antibody (NBP1-87528)

View related products by pathway.

PTMs for Filaggrin Antibody (NBP1-87528)

Learn more about PTMs related to Filaggrin Antibody (NBP1-87528).
 

Research Areas for Filaggrin Antibody (NBP1-87528)

Find related products by research area.

Blogs on Filaggrin

There are no specific blogs for Filaggrin, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Agnès Tessier
02/27/2020
Application: IHC-P
Species: Human

Bioinformatics

Gene Symbol FLG
COVID-19 update