PAD3 Antibody


Orthogonal Strategies: Western Blot: PAD3 Antibody [NBP1-92240] - Human cell lines RT-4 and PC-3 using Anti-PADI3 antibody. Corresponding PADI3 RNA-seq data are presented for the same cell lines. Loading control: more
Immunocytochemistry/ Immunofluorescence: PAD3 Antibody [NBP1-92240] - Staining of human cell line A549 shows localization to nucleoplasma, cytosol and vesicles. Antibody staining is shown in green.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Validated by:

Orthogonal Strategies


Order Details

PAD3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: FRMLLASPGACFKLFQEKQKCGHGRALLFQGVVDDEQVKTISINQVLSNKDLINYNKFVQSCIDWNREV
Specificity of human PAD3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunofluorescence in cell lines (ICC-IF) Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100
Theoretical MW
75 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
PAD3 Protein (NBP1-92240PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (80%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PAD3 Antibody

  • EC
  • MGC126307
  • PAD3
  • PDI3MGC126308
  • peptidyl arginine deiminase, type III
  • Peptidylarginine deiminase III
  • Protein-arginine deiminase type III
  • protein-arginine deiminase type-3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt, Rb
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ICC

Publications for PAD3 Antibody (NBP1-92240) (0)

There are no publications for PAD3 Antibody (NBP1-92240).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PAD3 Antibody (NBP1-92240) (0)

There are no reviews for PAD3 Antibody (NBP1-92240). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PAD3 Antibody (NBP1-92240) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for PAD3 Antibody (NBP1-92240)

Discover related pathways, diseases and genes to PAD3 Antibody (NBP1-92240). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PAD3 Antibody (NBP1-92240)

Discover more about diseases related to PAD3 Antibody (NBP1-92240).

Pathways for PAD3 Antibody (NBP1-92240)

View related products by pathway.

Blogs on PAD3

There are no specific blogs for PAD3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PAD3 Antibody and receive a gift card or discount.


Gene Symbol PADI3