PAD3 Antibody

Images

 
Western Blot: PAD3 Antibody [NBP1-92240] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: PAD3 Antibody [NBP1-92240] - Staining of human urinary bladder shows strong cytoplasmic and membranous positivity in urothelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PAD3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FRMLLASPGACFKLFQEKQKCGHGRALLFQGVVDDEQVKTISINQVLSNKDLINYNKFVQSCIDWNREV
Specificity
Specificity of human PAD3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PADI3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval method is recommended.
Theoretical MW
75 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
PAD3 Protein (NBP1-92240PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PAD3 Antibody

  • EC 3.5.3.15
  • MGC126307
  • PAD3
  • PDI3MGC126308
  • peptidyl arginine deiminase, type III
  • Peptidylarginine deiminase III
  • Protein-arginine deiminase type III
  • protein-arginine deiminase type-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02082
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-91834
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37761
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37918
Species: Hu
Applications: IHC, IHC-P
NBP1-80956
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-87527
Species: Hu
Applications: IHC, IHC-P
NB110-75039
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88691
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56530
Species: Hu
Applications: WB
NBP2-31614
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31333
Species: Hu, Rt, Rb
Applications: WB, ICC/IF, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC

Publications for PAD3 Antibody (NBP1-92240) (0)

There are no publications for PAD3 Antibody (NBP1-92240).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PAD3 Antibody (NBP1-92240) (0)

There are no reviews for PAD3 Antibody (NBP1-92240). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PAD3 Antibody (NBP1-92240) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PAD3 Antibody (NBP1-92240)

Discover related pathways, diseases and genes to PAD3 Antibody (NBP1-92240). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PAD3 Antibody (NBP1-92240)

Discover more about diseases related to PAD3 Antibody (NBP1-92240).
 

Pathways for PAD3 Antibody (NBP1-92240)

View related products by pathway.

Blogs on PAD3

There are no specific blogs for PAD3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PAD3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PADI3
Entrez
Uniprot