PAD3 Antibody - BSA Free

Western Blot: PAD3 Antibody [NBP1-92240] - Human cell lines RT-4 and PC-3 using Anti-PADI3 antibody. Corresponding PADI3 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.

Immunocytochemistry/Immunofluorescence: PAD3 Antibody [NBP1-92240] - Staining of human cell line A549 shows localization to nucleoplasma, cytosol and vesicles. Antibody staining is shown in green.

Analysis in human cell lines RT-4 and PC-3 using Anti-PADI3 antibody. Corresponding PADI3 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.

Staining of human cell line A549 shows localization to nucleoplasma, cytosol and vesicles.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PAD3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PAD3 Antibody - BSA Free (NBP1-92240) is a polyclonal antibody validated for use in WB and ICC/IF. Anti-PAD3 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FRMLLASPGACFKLFQEKQKCGHGRALLFQGVVDDEQVKTISINQVLSNKDLINYNKFVQSCIDWNREV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PADI3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF Fixation/Permeabilization: PFA/Triton X-100.
• Theoretical MW: 75 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  PAD3 Protein (NBP1-92240PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (80%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PAD3 Antibody - BSA Free

• EC 3.5.3.15
• MGC126307
• PAD3
• PDI3MGC126308
• peptidyl arginine deiminase, type III
• Peptidylarginine deiminase III
• Protein-arginine deiminase type III
• protein-arginine deiminase type-3

Background

PADI3 / PAD3 catalyzes the deimination of arginine residues of proteins. It belongs to the protein arginine deiminase family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PAD3 Antibody (NBP1-92240)(1)

Publication using NBP1-92240

• Padhi A, Rekha RS, Benrejdal L et Al. Baricitinib Blocks Cytokine-Mediated Downregulation of PAD1 in Human Keratinocytes: A Possible Molecular Link to the Effects of JAK Inhibitors in Atopic Dermatitis J Invest Dermatol 2023-06-26 [PMID: 36641131]

Bioinformatics

• Gene Symbol: PADI3
• Entrez:
  • 51702(Human)
• Uniprot:
  • Q9ULW8(Human)