PSMD14 Antibody

Images

 
Western Blot: PSMD14 Antibody [NBP1-80956] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: PSMD14 Antibody [NBP1-80956] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.
Immunohistochemistry-Paraffin: PSMD14 Antibody [NBP1-80956] - Staining of human hippocampus shows strong nuclear positivity in neuronal cells.
Western Blot: PSMD14 Antibody [NBP1-80956] - Analysis in human cell line HepG2.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PSMD14 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDA
Specificity
Specificity of human, mouse, rat PSMD14 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PSMD14
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PSMD14 Protein (NBP1-80956PEP)
Publications
Read Publications using
NBP1-80956 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24556687)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PSMD14 Antibody

  • EC 3.1.2.15
  • EC 3.4.19.-
  • pad1
  • POH126S proteasome non-ATPase regulatory subunit 14,26S proteasome regulatory subunit RPN11
  • proteasome (prosome, macropain) 26S subunit, non-ATPase, 14
  • Rpn11
  • RPN11,26S proteasome-associated PAD1 homolog 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-495
Species: Hu, Mu, Rt, Dr
Applications: WB, ICC/IF, IHC, IP
NBP2-38612
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-75039
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56530
Species: Hu
Applications: WB
NBP2-67861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02082
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-90821
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37918
Species: Hu
Applications: IHC, IHC-P
AF5650
Species: Hu
Applications: WB, IHC
NBP1-76831
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1988
Species: Hu
Applications: WB, IP, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NB300-514
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-92240
Species: Hu
Applications: WB, ICC/IF
NBP2-57955
Species: Hu
Applications: WB, ICC/IF
NBP1-91834
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31564
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
NBP1-80956
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PSMD14 Antibody (NBP1-80956)(4)

Reviews for PSMD14 Antibody (NBP1-80956) (0)

There are no reviews for PSMD14 Antibody (NBP1-80956). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PSMD14 Antibody (NBP1-80956) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PSMD14 Antibody (NBP1-80956)

Discover related pathways, diseases and genes to PSMD14 Antibody (NBP1-80956). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PSMD14 Antibody (NBP1-80956)

Discover more about diseases related to PSMD14 Antibody (NBP1-80956).
 

Pathways for PSMD14 Antibody (NBP1-80956)

View related products by pathway.

PTMs for PSMD14 Antibody (NBP1-80956)

Learn more about PTMs related to PSMD14 Antibody (NBP1-80956).
 

Research Areas for PSMD14 Antibody (NBP1-80956)

Find related products by research area.

Blogs on PSMD14

There are no specific blogs for PSMD14, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PSMD14 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PSMD14