OVGP1 Antibody

Images

 
Immunohistochemistry-Paraffin: OVGP1 Antibody [NBP2-32357] - Staining of human fallopian tube shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

OVGP1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GTHPRMGNLGLQMEAENRMMLSSSPVIQLPEQTPLAFDNRFVPIYGNHSSVNSVTPQTSPLSLKKEIPENSAVDE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OVGP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
OVGP1 Protein (NBP2-32357PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for OVGP1 Antibody

  • CHIT5
  • EGP
  • Estrogen-dependent oviduct protein
  • MUC9
  • mucin 9
  • mucin-9
  • OGP
  • oviduct glycoprotein
  • oviductal glycoprotein 1, 120kDa
  • Oviductal glycoprotein
  • oviductin
  • oviduct-specific glycoprotein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-80533
Species: Mu
Applications: WB
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NBP1-47778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1182
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-30830
Species: Hu
Applications: IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-44374
Species: Hu
Applications: Flow, IHC-P, IF
NBP2-15196
Species: Hu, Mu, Rt, Po, Ch, Fe, Pm, Rb, Bv(-)
Applications: Flow, ICC/IF, IHC-Fr, IHC-P, Flow-IC
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for OVGP1 Antibody (NBP2-32357) (0)

There are no publications for OVGP1 Antibody (NBP2-32357).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OVGP1 Antibody (NBP2-32357) (0)

There are no reviews for OVGP1 Antibody (NBP2-32357). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for OVGP1 Antibody (NBP2-32357) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional OVGP1 Products

Bioinformatics Tool for OVGP1 Antibody (NBP2-32357)

Discover related pathways, diseases and genes to OVGP1 Antibody (NBP2-32357). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OVGP1 Antibody (NBP2-32357)

Discover more about diseases related to OVGP1 Antibody (NBP2-32357).
 

Pathways for OVGP1 Antibody (NBP2-32357)

View related products by pathway.

PTMs for OVGP1 Antibody (NBP2-32357)

Learn more about PTMs related to OVGP1 Antibody (NBP2-32357).

Blogs on OVGP1

There are no specific blogs for OVGP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OVGP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OVGP1