OVGP1 Antibody


Immunohistochemistry-Paraffin: OVGP1 Antibody [NBP2-32357] - Staining of human prostate shows low expression as expected.
Immunohistochemistry-Paraffin: OVGP1 Antibody [NBP2-32357] - Staining of human fallopian tube shows high expression.
Immunohistochemistry-Paraffin: OVGP1 Antibody [NBP2-32357] - Staining in human fallopian tube and prostate tissues using anti-OVGP1 antibody. Corresponding OVGP1 RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

OVGP1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: GTHPRMGNLGLQMEAENRMMLSSSPVIQLPEQTPLAFDNRFVPIYGNHSSVNSVTPQTSPLSLKKEIPENSAVDE
Specificity of human OVGP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
OVGP1 Protein (NBP2-32357PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for OVGP1 Antibody

  • CHIT5
  • EGP
  • Estrogen-dependent oviduct protein
  • MUC9
  • mucin 9
  • mucin-9
  • OGP
  • oviduct glycoprotein
  • oviductal glycoprotein 1, 120kDa
  • Oviductal glycoprotein
  • oviductin
  • oviduct-specific glycoprotein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Mu
Applications: WB
Species: Hu, Mu, Rt, Po, Bv, Eq, Gt, GP, Rb
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: Flow, IHC-P, IF
Species: Hu, Mu, Rt, Po, Ch, Fe, Pm, Rb, Bv(-)
Applications: Flow, ICC/IF, IHC-Fr, IHC-P, Flow-IC
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow

Publications for OVGP1 Antibody (NBP2-32357) (0)

There are no publications for OVGP1 Antibody (NBP2-32357).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OVGP1 Antibody (NBP2-32357) (0)

There are no reviews for OVGP1 Antibody (NBP2-32357). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for OVGP1 Antibody (NBP2-32357) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional OVGP1 Products

Bioinformatics Tool for OVGP1 Antibody (NBP2-32357)

Discover related pathways, diseases and genes to OVGP1 Antibody (NBP2-32357). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OVGP1 Antibody (NBP2-32357)

Discover more about diseases related to OVGP1 Antibody (NBP2-32357).

Pathways for OVGP1 Antibody (NBP2-32357)

View related products by pathway.

PTMs for OVGP1 Antibody (NBP2-32357)

Learn more about PTMs related to OVGP1 Antibody (NBP2-32357).

Blogs on OVGP1

There are no specific blogs for OVGP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our OVGP1 Antibody and receive a gift card or discount.


Gene Symbol OVGP1