OVGP1 Antibody

Images

 
Western Blot: OVGP1 Antibody [NBP1-79798] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

OVGP1 Antibody Summary

Immunogen
Synthetic peptide directed towards the C terminal of human OVGP1The immunogen for this antibody is OVGP1. Peptide sequence QLPEQTPLAFDNRFVPIYGNHSSVNSVTPQTSPLSLKKEIPENSAVDEEA.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OVGP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against OVGP1 and was validated on Western blot.
Theoretical MW
75 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for OVGP1 Antibody

  • CHIT5
  • EGP
  • Estrogen-dependent oviduct protein
  • MUC9
  • mucin 9
  • mucin-9
  • OGP
  • oviduct glycoprotein
  • oviductal glycoprotein 1, 120kDa
  • Oviductal glycoprotein
  • oviductin
  • oviduct-specific glycoprotein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-80533
Species: Mu
Applications: WB
NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NBP1-47778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1182
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-30830
Species: Hu
Applications: IHC, IHC-P
NBP1-86614
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55298
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB300-560
Species: Hu, Mu, Rt, Av, Bv, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
NBP2-44374
Species: Hu
Applications: Flow, IHC-P, IF
NBP2-15196
Species: Hu, Mu, Rt, Po, Ch, Fe, Pm, Rb, Bv(-)
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, Flow-IC
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-79798
Species: Hu
Applications: WB

Publications for OVGP1 Antibody (NBP1-79798) (0)

There are no publications for OVGP1 Antibody (NBP1-79798).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OVGP1 Antibody (NBP1-79798) (0)

There are no reviews for OVGP1 Antibody (NBP1-79798). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OVGP1 Antibody (NBP1-79798) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for OVGP1 Antibody (NBP1-79798)

Discover related pathways, diseases and genes to OVGP1 Antibody (NBP1-79798). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OVGP1 Antibody (NBP1-79798)

Discover more about diseases related to OVGP1 Antibody (NBP1-79798).
 

Pathways for OVGP1 Antibody (NBP1-79798)

View related products by pathway.

PTMs for OVGP1 Antibody (NBP1-79798)

Learn more about PTMs related to OVGP1 Antibody (NBP1-79798).

Blogs on OVGP1

There are no specific blogs for OVGP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OVGP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OVGP1
Uniprot