Osteocalcin Antibody (190125) [Allophycocyanin]

Saos-2 human osteosarcoma cell line was stained with Mouse Anti-Human Osteocalcin APC-conjugated Monoclonal Antibody (Catalog # IC1419A, filled histogram) or isotype control antibody (Catalog # IC002A, open histogram). To facilitate intracellular staining, cells were fixed with Flow Cytometry Fixation Buffer (Catalog # FC004) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (Catalog # FC005). View our protocol for Staining Intracellular Molecules.

Human osteoblasts were stained with Mouse Anti-Human Osteocalcin APC-conjugated Monoclonal Antibody (Catalog # IC1419A, filled histogram) or isotype control antibody (Catalog # IC002A, open histogram). To facilitate intracellular staining, cells were fixed with Flow Cytometry Fixation Buffer (Catalog # FC004) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (Catalog # FC005). View our protocol for Staining Intracellular Molecules.

• Reactivity: Hu
• Applications: Flow
• Clone: 190125
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Allophycocyanin

Osteocalcin Antibody (190125) [Allophycocyanin] Summary

• Immunogen: Human Osteocalcin synthetic peptide
  YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
  Accession # P02818
• Specificity: Detects human Osteocalcin in direct ELISAs.
• Source: N/A
• Isotype: IgG1
• Clonality: Monoclonal
• Host: Mouse
• Gene: BGLAP
• Purity Statement: Protein A or G purified from hybridoma culture supernatant

Applications/Dilutions

• Dilutions:
  • Intracellular Staining by Flow Cytometry 10 uL/10^6 cells

Packaging, Storage & Formulations

• Storage: Protect from light. Do not freeze.
  • 12 months from date of receipt, 2 to 8 °C as supplied.
• Buffer: Supplied in a saline solution containing BSA and Sodium Azide.
• Preservative: Sodium Azide

Notes

This product is produced by and ships from R&D Systems, Inc., a Bio-Techne brand.

Alternate Names for Osteocalcin Antibody (190125) [Allophycocyanin]

• BGLAP
• BGP
• bone gamma-carboxyglutamate (gla) protein (osteocalcin)
• bone gamma-carboxyglutamate (gla) protein
• Bone Gla protein
• Gamma-carboxyglutamic acid-containing protein
• OC
• OCN
• Osteocalcin

Background

Osteocalcin, also known as Bone gamma -Carboxyglutamic Acid Protein, is a secreted protein whose expression is restricted to cells of the osteoblast lineage (1). It has been frequently used as a marker for osteoblast lineage cells.

1. Lian, J.B. et al. (1999) Vitamin. Horm. 55:443.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Osteocalcin Antibody (IC1419A)(3)

Publications using IC1419A

• Li, J;Wang, H;Ma, P;Li, T;Ren, J;Zhang, J;Zhou, M;He, Y;Yang, T;He, W;Mi, MT;Liu, YW;Dai, SS; Osteocalcin-expressing neutrophils from skull bone marrow exert immunosuppressive and neuroprotective effects after TBI Cell reports 2024-08-29 [PMID: 39213156] (Flow Cytometry, Human)
• Y Abe, M Chiba, S Yaklai, RS Pechayco, H Suzuki, T Takahashi Increase in bone metabolic markers and circulating osteoblast-lineage cells after orthognathic surgery Sci Rep, 2019-12-27;9(1):20106. 2019-12-27 [PMID: 31882726] (Flow Cytometry, Human)
• K Takahashi, M Satoh, Y Takahashi, T Osaki, T Nasu, M Tamada, H Okabayashi, M Nakamura, Y Morino Dysregulation of ossification related microRNAs in circulating osteogenic progenitor cells obtained from patients with aortic stenosis Clin Sci, 2016-04-14;0(0):. 2016-04-14 [PMID: 27129184] (Flow Cytometry, Human)

Bioinformatics

• Gene Symbol: BGLAP
• Uniprot:
  • P02818()