Osteocalcin Antibody (190125) [mFluor Violet 610 SE]

• Reactivity: Hu, Rt
• Applications: IHC, CyTOF-ready, Flow, ICC/IF
• Clone: 190125
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: mFluor Violet 610 SE

Osteocalcin Antibody (190125) [mFluor Violet 610 SE] Summary

• Immunogen: Human Osteocalcin synthetic peptide
  YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
  Accession # P02818
• Specificity: Detects human Osteocalcin in direct ELISAs.
• Isotype: IgG1
• Clonality: Monoclonal
• Host: Mouse
• Gene: BGLAP
• Purity: Protein A or G purified from hybridoma culture supernatant

Applications/Dilutions

• Dilutions:
  • CyTOF-ready
  • Immunocytochemistry
  • Immunohistochemistry
  • Intracellular Staining by Flow Cytometry
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Protein A or G purified from hybridoma culture supernatant

Notes

mFluor(TM) is a trademark of AAT Bioquest, Inc. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for Osteocalcin Antibody (190125) [mFluor Violet 610 SE]

• BGLAP
• BGP
• bone gamma-carboxyglutamate (gla) protein (osteocalcin)
• bone gamma-carboxyglutamate (gla) protein
• Bone Gla protein
• Gamma-carboxyglutamic acid-containing protein
• OC
• OCN
• Osteocalcin

Background

Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BGLAP