We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Osteocalcin Antibody (190125) [Phycoerythrin]

Images

 
IC002P, open histogram). To facilitate intracellular staining, cells were fixed with Flow Cytometry Fixation Buffer (Catalog # FC004) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (Catalog # FC005). View our protocol for Staining Intracellular Molecules." > Differentiated human mesemchymal progenitor cells were stained with Mouse Anti-Human Osteocalcin PE-conjugated Monoclonal Antibody (Catalog # IC1419P, filled histogram) or isotype control antibody (Catalog # <a class=IC002P, open histogram). To facilitate intracellular staining, cells were fixed with Flow Cytometry Fixation Buffer (Catalog # FC004) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (Catalog # FC005). View our protocol for Staining Intracellular Molecules." title="Differentiated human mesemchymal progenitor cells were stained with Mouse Anti-Human Osteocalcin PE-conjugated Monoclonal Antibody (Catalog # IC1419P, filled histogram) or isotype control antibody (Catalog # IC002P, open histogram). To facilitate intracellular staining, cells were fixed with Flow Cytometry Fixation Buffer (Catalog # FC004) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (Catalog # FC005). View our protocol for Staining Intracellular Molecules." />
Differentiated human mesemchymal progenitor cells were stained with Mouse Anti-Human Osteocalcin PE-conjugated Monoclonal Antibody (Catalog # IC1419P, filled histogram) or isotype control antibody (Catalog # ...read more
IC002P, open histogram). To facilitate intracellular staining, cells were fixed with Flow Cytometry Fixation Buffer (Catalog # FC004) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (Catalog # FC005). View our protocol for Staining Intracellular Molecules." > IC002P, open histogram). To facilitate intracellular staining, cells were fixed with Flow Cytometry Fixation Buffer (Catalog # FC004) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (Catalog # FC005). View our protocol for Staining Intracellular Molecules." title="Saos-2 human osteosarcoma cell line was stained with Mouse Anti-Human Osteocalcin PE-conjugated Monoclonal Antibody (Catalog # IC1419P, filled histogram) or isotype control antibody (Catalog # IC002P, open histogram). To facilitate intracellular staining, cells were fixed with Flow Cytometry Fixation Buffer (Catalog # FC004) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (Catalog # FC005). View our protocol for Staining Intracellular Molecules." />
Saos-2 human osteosarcoma cell line was stained with Mouse Anti-Human Osteocalcin PE-conjugated Monoclonal Antibody (Catalog # IC1419P, filled histogram) or isotype control antibody (Catalog # ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications Flow
Clone
190125
Clonality
Monoclonal
Host
Mouse
Conjugate
Phycoerythrin

Order Details

Osteocalcin Antibody (190125) [Phycoerythrin] Summary

Immunogen
Human Osteocalcin synthetic peptide
YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
Accession # P02818
Specificity
Detects human Osteocalcin in direct ELISAs.
Source
N/A
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
BGLAP
Purity Statement
Protein A or G purified from hybridoma culture supernatant
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Intracellular Staining by Flow Cytometry 10 uL/10^6 cells
Publications
Read Publications using
IC1419P in the following applications:

Packaging, Storage & Formulations

Storage
Protect from light. Do not freeze.
  • 12 months from date of receipt, 2 to 8 °C as supplied.
Buffer
Supplied in a saline solution containing BSA and Sodium Azide.
Preservative
Sodium Azide

Notes

This product is produced by and ships from R&D Systems, Inc., a Bio-Techne brand.

Alternate Names for Osteocalcin Antibody (190125) [Phycoerythrin]

  • BGLAP
  • BGP
  • bone gamma-carboxyglutamate (gla) protein (osteocalcin)
  • bone gamma-carboxyglutamate (gla) protein
  • Bone Gla protein
  • Gamma-carboxyglutamic acid-containing protein
  • OC
  • OCN
  • Osteocalcin

Background

Osteocalcin, also known as Bone gamma -Carboxyglutamic Acid Protein, is a secreted protein whose expression is restricted to cells of the osteoblast lineage (1). It has been frequently used as a marker for osteoblast lineage cells.
  1. Lian, J.B. et al. (1999) Vitamin. Horm. 55:443.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-65676
Species: Hu
Applications: ELISA, IHC, IHC-Fr,  IHC-P
NBP1-89953
Species: Hu
Applications: IHC,  IHC-P
NB300-164
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KO, PLA, WB
AF808
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
NBP2-92749
Species: Hu, Mu
Applications: ELISA, WB
NB110-3638
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, RI, WB
DPI00
Species: Hu
Applications: ELISA
NBP3-15742
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
DCC270
Species: Hu
Applications: ELISA
NBP1-89133
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-25358
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-86713
Species: Hu
Applications: IHC,  IHC-P
DY805
Species: Hu
Applications: ELISA
291-G1
Species: Hu
Applications: BA
355-BM
Species: Hu, Mu, Rt
Applications: BA
4014-SP
Species: Hu
Applications: BA
NBP2-82180
Species: Hu
Applications: ELISA
NBP1-47863
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
IC1419P
Species: Hu
Applications: Flow

Publications for Osteocalcin Antibody (IC1419P)(7)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: Flow Cytometry.


Filter By Application
Flow Cytometry
(6)
All Applications
Filter By Species
Human
(6)
All Species
Showing Publications 1 - 7 of 7.
Publications using IC1419P Applications Species
Saula Vigili de Kreutzenberg, Alessandra Giannella, Giulio Ceolotto, Elisabetta Faggin, Roberta Cappellari, Marta Mazzucato et al. A miR-125/Sirtuin-7 pathway drives the pro-calcific potential of myeloid cells in diabetic vascular disease Diabetologia 9/1/2022 [PMID: 35708762]
YH Chan, MC Ngai, Y Chen, MZ Wu, YJ Yu, Z Zhen, K Lai, T Cheung, LM Ho, HY Chung, CS Lau, HF Tse, KH Yiu Cumulative Rheumatic Inflammation Modulates the Bone-Vascular Axis and Risk of Coronary Calcification J Am Heart Assoc, 2019-06-04;8(11):e011540. 2019-06-04 [PMID: 31130038] (Flow Cytometry, Human) Flow Cytometry Human
F Sassi, I Buondonno, C Luppi, E Spertino, E Stratta, M Di Stefano, M Ravazzoli, G Isaia, M Trento, P Passera, M Porta, GC Isaia, P D'Amelio Type 2 diabetes affects bone cells precursors and bone turnover BMC Endocr Disord, 2018-08-08;18(1):55. 2018-08-08 [PMID: 30089481] (Flow Cytometry, Human) Flow Cytometry Human
P Gunawarden, A Al Saedi, L Singh, S Bermeo, S Vogrin, S Phu, P Suriyaarac, RJ Pignolo, G Duque Age, gender, and percentage of circulating osteoprogenitor (COP) cells: The COP Study Exp. Gerontol., 2017-06-06;96(0):68-72. 2017-06-06 [PMID: 28599951] (Flow Cytometry, Human) Flow Cytometry Human
NZ-GMP Approved Serum Improve hDPSC Osteogenic Commitment and Increase Angiogenic Factor Expression Front Physiol, 2016-08-19;7(0):354. 2016-08-19 [PMID: 27594842] (Flow Cytometry, Human) Flow Cytometry Human
Resende A, dos Reis L, Dias C, Custodio M, Jorgetti V, Woronik V Bone disease in newly diagnosed lupus nephritis patients. PLoS ONE, 2014-09-17;9(9):e106728. 2014-09-17 [PMID: 25229495] (Flow Cytometry, Human) Flow Cytometry Human
Paino F, La Noce M, Tirino V, Naddeo P, Desiderio V, Pirozzi G, De Rosa A, Laino L, Altucci L, Papaccio G Histone deacetylase inhibition with valproic acid downregulates osteocalcin gene expression in human dental pulp stem cells and osteoblasts: evidence for HDAC2 involvement. Stem Cells, 2014-01-01;32(1):279-89. 2014-01-01 [PMID: 24105979] (Flow Cytometry, Human) Flow Cytometry Human

Reviews for Osteocalcin Antibody (IC1419P) (0)

There are no reviews for Osteocalcin Antibody (IC1419P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Osteocalcin Antibody (IC1419P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Osteocalcin Antibody (190125) [Phycoerythrin] and receive a gift card or discount.

Bioinformatics

Gene Symbol BGLAP
Uniprot