Osteocalcin Antibody (190125) [Phycoerythrin]

Differentiated human mesemchymal progenitor cells were stained with Mouse Anti-Human Osteocalcin PE-conjugated Monoclonal Antibody (Catalog # IC1419P, filled histogram) or isotype control antibody (Catalog # IC002P, open histogram). To facilitate intracellular staining, cells were fixed with Flow Cytometry Fixation Buffer (Catalog # FC004) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (Catalog # FC005). View our protocol for Staining Intracellular Molecules.

Saos-2 human osteosarcoma cell line was stained with Mouse Anti-Human Osteocalcin PE-conjugated Monoclonal Antibody (Catalog # IC1419P, filled histogram) or isotype control antibody (Catalog # IC002P, open histogram). To facilitate intracellular staining, cells were fixed with Flow Cytometry Fixation Buffer (Catalog # FC004) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (Catalog # FC005). View our protocol for Staining Intracellular Molecules.

• Reactivity: Hu
• Applications: Flow
• Clone: 190125
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Phycoerythrin

Osteocalcin Antibody (190125) [Phycoerythrin] Summary

• Immunogen: Human Osteocalcin synthetic peptide
  YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
  Accession # P02818
• Specificity: Detects human Osteocalcin in direct ELISAs.
• Source: N/A
• Isotype: IgG1
• Clonality: Monoclonal
• Host: Mouse
• Gene: BGLAP
• Purity Statement: Protein A or G purified from hybridoma culture supernatant

Applications/Dilutions

• Dilutions:
  • Intracellular Staining by Flow Cytometry 10 uL/10^6 cells

Packaging, Storage & Formulations

• Storage: Protect from light. Do not freeze.
  • 12 months from date of receipt, 2 to 8 °C as supplied.
• Buffer: Supplied in a saline solution containing BSA and Sodium Azide.
• Preservative: Sodium Azide

Notes

This product is produced by and ships from R&D Systems, Inc., a Bio-Techne brand.

Alternate Names for Osteocalcin Antibody (190125) [Phycoerythrin]

• BGLAP
• BGP
• bone gamma-carboxyglutamate (gla) protein (osteocalcin)
• bone gamma-carboxyglutamate (gla) protein
• Bone Gla protein
• Gamma-carboxyglutamic acid-containing protein
• OC
• OCN
• Osteocalcin

Background

Osteocalcin, also known as Bone gamma -Carboxyglutamic Acid Protein, is a secreted protein whose expression is restricted to cells of the osteoblast lineage (1). It has been frequently used as a marker for osteoblast lineage cells.

1. Lian, J.B. et al. (1999) Vitamin. Horm. 55:443.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Osteocalcin Antibody (IC1419P)(7)

Publications using IC1419P

• Saula Vigili de Kreutzenberg, Alessandra Giannella, Giulio Ceolotto, Elisabetta Faggin, Roberta Cappellari, Marta Mazzucato et al. A miR-125/Sirtuin-7 pathway drives the pro-calcific potential of myeloid cells in diabetic vascular disease Diabetologia 9/1/2022 [PMID: 35708762]
• YH Chan, MC Ngai, Y Chen, MZ Wu, YJ Yu, Z Zhen, K Lai, T Cheung, LM Ho, HY Chung, CS Lau, HF Tse, KH Yiu Cumulative Rheumatic Inflammation Modulates the Bone-Vascular Axis and Risk of Coronary Calcification J Am Heart Assoc, 2019-06-04;8(11):e011540. 2019-06-04 [PMID: 31130038] (Flow Cytometry, Human)
• F Sassi, I Buondonno, C Luppi, E Spertino, E Stratta, M Di Stefano, M Ravazzoli, G Isaia, M Trento, P Passera, M Porta, GC Isaia, P D'Amelio Type 2 diabetes affects bone cells precursors and bone turnover BMC Endocr Disord, 2018-08-08;18(1):55. 2018-08-08 [PMID: 30089481] (Flow Cytometry, Human)
• P Gunawarden, A Al Saedi, L Singh, S Bermeo, S Vogrin, S Phu, P Suriyaarac, RJ Pignolo, G Duque Age, gender, and percentage of circulating osteoprogenitor (COP) cells: The COP Study Exp. Gerontol., 2017-06-06;96(0):68-72. 2017-06-06 [PMID: 28599951] (Flow Cytometry, Human)
• NZ-GMP Approved Serum Improve hDPSC Osteogenic Commitment and Increase Angiogenic Factor Expression Front Physiol, 2016-08-19;7(0):354. 2016-08-19 [PMID: 27594842] (Flow Cytometry, Human)
• Resende A, dos Reis L, Dias C, Custodio M, Jorgetti V, Woronik V Bone disease in newly diagnosed lupus nephritis patients. PLoS ONE, 2014-09-17;9(9):e106728. 2014-09-17 [PMID: 25229495] (Flow Cytometry, Human)
• Paino F, La Noce M, Tirino V, Naddeo P, Desiderio V, Pirozzi G, De Rosa A, Laino L, Altucci L, Papaccio G Histone deacetylase inhibition with valproic acid downregulates osteocalcin gene expression in human dental pulp stem cells and osteoblasts: evidence for HDAC2 involvement. Stem Cells, 2014-01-01;32(1):279-89. 2014-01-01 [PMID: 24105979] (Flow Cytometry, Human)

Bioinformatics

• Gene Symbol: BGLAP
• Uniprot:
  • P02818()