Osteocalcin Antibody (190125) [Alexa Fluor® 750] Summary
| Immunogen |
Human Osteocalcin synthetic peptide YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV Accession # P02818 |
| Specificity |
Detects human Osteocalcin in direct ELISAs. |
| Isotype |
IgG1 |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
BGLAP |
| Purity Statement |
Protein A or G purified from hybridoma culture supernatant |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Intracellular Staining by Flow Cytometry 0.25-1 ug/10^6 cells
|
| Application Notes |
Flow Cytometry: Please use 0.25-1 ug of conjugated antibody per 10e6 cells. |
Packaging, Storage & Formulations
| Storage |
Store the unopened product at 2 - 8 °C. Do not use past expiration date. |
| Buffer |
Supplied 0.2 mg/mL in a saline solution containing BSA and Sodium Azide. |
| Preservative |
0.09% Sodium Azide |
| Concentration |
Please see the vial label for concentration. If unlisted please contact technical services. |
Notes
This product is provided under an agreement between Life Technologies Corporation and R&D Systems, Inc, and the manufacture, use, sale or import of this product is subject to one or more US patents and corresponding non-US equivalents, owned by Life Technologies Corporation and its affiliates. The purchase of this product conveys to the buyer the non-transferable right to use the purchased amount of the product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components (1) in manufacturing; (2) to provide a service, information, or data to an unaffiliated third party for payment; (3) for therapeutic, diagnostic or prophylactic purposes; (4) to resell, sell, or otherwise transfer this product or its components to any third party, or for any other commercial purpose. Life Technologies Corporation will not assert a claim against the buyer of the infringement of the above patents based on the manufacture, use or sale of a commercial product developed in research by the buyer in which this product or its components was employed, provided that neither this product nor any of its components was used in the manufacture of such product. For information on purchasing a license to this product for purposes other than research, contact Life Technologies Corporation, Cell Analysis Business Unit, Business Development, 29851 Willow Creek Road, Eugene, OR 97402, Tel: (541) 465-8300. Fax: (541) 335-0354.
This product is produced by and ships from R&D Systems, Inc., a Bio-Techne brand.
Alternate Names for Osteocalcin Antibody (190125) [Alexa Fluor® 750]
Background
Osteocalcin, also known as Bone gamma -Carboxyglutamic Acid Protein, is a secreted protein whose expression is restricted to cells of the osteoblast lineage (1). It has been frequently used as a marker for osteoblast lineage cells.
- Lian, J.B. et al. (1999) Vitamin. Horm. 55:443.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, WB
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, PLA, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
Species: Hu, Mu
Applications: ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: Flow
Publications for Osteocalcin Antibody (IC1419S) (0)
There are no publications for Osteocalcin Antibody (IC1419S).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Osteocalcin Antibody (IC1419S) (0)
There are no reviews for Osteocalcin Antibody (IC1419S).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Osteocalcin Antibody (IC1419S) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Osteocalcin Products
Blogs on Osteocalcin