Osteocalcin Antibody (190125) [Alexa Fluor® 488]

Saos-2 human osteosarcoma cell line was stained with Mouse Anti-Human Osteocalcin Alexa Fluor® 488-conjugated Monoclonal Antibody (Catalog # IC1419G, filled histogram) or isotype control antibody (Catalog # IC002G, open histogram). To facilitate intracellular staining, cells were fixed with Flow Cytometry Fixation Buffer (Catalog # FC004) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (Catalog # FC005). View our protocol for Staining Intracellular Molecules.

Human osteoblasts were stained with Mouse Anti-Human Osteocalcin Alexa Fluor® 488-conjugated Monoclonal Antibody (Catalog # IC1419G, filled histogram) or isotype control antibody (Catalog # IC002G, open histogram). To facilitate intracellular staining, cells were fixed with Flow Cytometry Fixation Buffer (Catalog # FC004) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (Catalog # FC005). View our protocol for Staining Intracellular Molecules.

• Reactivity: Hu
• Applications: Flow
• Clone: 190125
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Alexa Fluor 488

Osteocalcin Antibody (190125) [Alexa Fluor® 488] Summary

• Immunogen: Human Osteocalcin synthetic peptide
  YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
  Accession # P02818
• Specificity: Detects human Osteocalcin in direct ELISAs.
• Source: N/A
• Isotype: IgG1
• Clonality: Monoclonal
• Host: Mouse
• Gene: BGLAP
• Purity Statement: Protein A or G purified from hybridoma culture supernatant

Applications/Dilutions

• Dilutions:
  • Intracellular Staining by Flow Cytometry 5 uL/10^6 cells

Packaging, Storage & Formulations

• Storage: Protect from light. Do not freeze.
  • 12 months from date of receipt, 2 to 8 °C as supplied.
• Buffer: Supplied in a saline solution containing BSA and Sodium Azide.
• Preservative: Sodium Azide

Notes

This product is provided under an agreement between Life Technologies Corporation and R&D Systems, Inc, and the manufacture, use, sale or import of this product is subject to one or more US patents and corresponding non-US equivalents, owned by Life Technologies Corporation and its affiliates. The purchase of this product conveys to the buyer the non-transferable right to use the purchased amount of the product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components (1) in manufacturing; (2) to provide a service, information, or data to an unaffiliated third party for payment; (3) for therapeutic, diagnostic or prophylactic purposes; (4) to resell, sell, or otherwise transfer this product or its components to any third party, or for any other commercial purpose. Life Technologies Corporation will not assert a claim against the buyer of the infringement of the above patents based on the manufacture, use or sale of a commercial product developed in research by the buyer in which this product or its components was employed, provided that neither this product nor any of its components was used in the manufacture of such product. For information on purchasing a license to this product for purposes other than research, contact Life Technologies Corporation, Cell Analysis Business Unit, Business Development, 29851 Willow Creek Road, Eugene, OR 97402, Tel: (541) 465-8300. Fax: (541) 335-0354.

This product is produced by and ships from R&D Systems, Inc., a Bio-Techne brand.

Alternate Names for Osteocalcin Antibody (190125) [Alexa Fluor® 488]

• BGLAP
• BGP
• bone gamma-carboxyglutamate (gla) protein (osteocalcin)
• bone gamma-carboxyglutamate (gla) protein
• Bone Gla protein
• Gamma-carboxyglutamic acid-containing protein
• OC
• OCN
• Osteocalcin

Background

Osteocalcin, also known as Bone gamma -Carboxyglutamic Acid Protein, is a secreted protein whose expression is restricted to cells of the osteoblast lineage (1). It has been frequently used as a marker for osteoblast lineage cells.

1. Lian, J.B. et al. (1999) Vitamin. Horm. 55:443.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Osteocalcin Antibody (IC1419G)(2)

Publications using IC1419G

• F Umrath, C Thomalla, S Pöschel, K Schenke-La, S Reinert, D Alexander Comparative Study of MSCA-1 and CD146 Isolated Periosteal Cell Subpopulations Cell. Physiol. Biochem., 2018-12-12;51(3):1193-1206. 2018-12-12 [PMID: 30541004] (Flow Cytometry, Human)
• E Maddaloni, Y Xia, K Park, S D'Eon, LJ Tinsley, R St-Louis, M Khamaisi, Q Li, GL King, HA Keenan High density lipoprotein modulates osteocalcin expression in circulating monocytes: a potential protective mechanism for cardiovascular disease in type 1 diabetes Cardiovasc Diabetol, 2017-09-16;16(1):116. 2017-09-16 [PMID: 28915881] (Flow Cytometry, Human)

Bioinformatics

• Gene Symbol: BGLAP
• Uniprot:
  • P02818()