Optineurin Antibody

Images

 
Western Blot: Optineurin Antibody [NBP1-84683] - Analysis in human cell line HDLM-2.
Immunocytochemistry/ Immunofluorescence: Optineurin Antibody [NBP1-84683] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: Optineurin Antibody [NBP1-84683] - Staining of human kidney shows weak cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: Optineurin Antibody [NBP1-84683] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: Optineurin Antibody [NBP1-84683] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: Optineurin Antibody [NBP1-84683] - Staining of human rectum shows moderate cytoplasmic positivity in cells in granular layer.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Optineurin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LELAEKALASKQLQMDEMKQTIAKQEEDLETMTILRAQMEVYCSDFHAERAAREKIHEEKEQLALQLAVLLKENDAFEDGGRQSLMEMQSRHGARTSDSDQQAYLVQRGAEDRDWRQQRNIPIHSCPKCGEVL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OPTN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Optineurin Protein (NBP1-84683PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Optineurin Antibody

  • FIP2FIP-2
  • GLC1Eglaucoma 1, open angle, E (adult-onset)
  • HIP7ALS12
  • Huntingtin interacting protein L
  • Huntingtin yeast partner L
  • Huntingtin-interacting protein 7
  • Huntingtin-interacting protein L
  • HYPLHIP-7
  • NEMO-related protein
  • NRPE3-14.7K-interacting protein
  • Optic neuropathy-inducing protein
  • optineurin
  • TFIIIA-INTP
  • Transcription factor IIIA-interacting protein
  • transcrption factor IIIA-interacting protein
  • tumor necrosis factor alpha-inducible cellular protein containing leucinezipper domains

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB3446
Species: Hu
Applications: WB
AF566
Species: Mu, Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
AF567
Species: Mu, Rt
Applications: WB, Simple Western, IHC, Block
NBP2-38364
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF7109
Species: Mu
Applications: WB, IHC
H00004218-M02
Species: Hu
Applications: WB, ELISA
NBP1-82527
Species: Hu
Applications: IHC, IHC-P
NBP2-24722
Species: Hu
Applications: WB, IHC-P
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
H00023435-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
AF1436
Species: Mu
Applications: WB
NB100-56705
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-30003
Species: Hu
Applications: WB, ICC/IF, IHC-P

Publications for Optineurin Antibody (NBP1-84683) (0)

There are no publications for Optineurin Antibody (NBP1-84683).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Optineurin Antibody (NBP1-84683) (0)

There are no reviews for Optineurin Antibody (NBP1-84683). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Optineurin Antibody (NBP1-84683) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Optineurin Products

Bioinformatics Tool for Optineurin Antibody (NBP1-84683)

Discover related pathways, diseases and genes to Optineurin Antibody (NBP1-84683). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Optineurin Antibody (NBP1-84683)

Discover more about diseases related to Optineurin Antibody (NBP1-84683).
 

Pathways for Optineurin Antibody (NBP1-84683)

View related products by pathway.

PTMs for Optineurin Antibody (NBP1-84683)

Learn more about PTMs related to Optineurin Antibody (NBP1-84683).
 

Research Areas for Optineurin Antibody (NBP1-84683)

Find related products by research area.

Blogs on Optineurin

There are no specific blogs for Optineurin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Optineurin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OPTN