| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ELISA, IHC |
| Clone | 2E12 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | MYO6 (NP_004990.2, 1188 a.a. ~ 1285 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KKKGWWYAHFDGPWIARQMELHPDKPPILLVAGKDDMEMCELNLEETGLTRKRGAEILPRQFEEIWERCGGIQYLQNAIESRQARPTYATAMLQSLLK |
| Specificity | This product is specific for Human MYO6 monoclonal antibody (M02), clone 2E12 [Gene ID: 4646]. |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | MYO6 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Use in Immunohistochemistry reported in scientific literature (PMID:34335185). |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
| Publication using H00004646-M02 | Applications | Species |
|---|---|---|
| Stalmann U, Franke Aj, Al-Moyed H Et Al. Otoferlin Is Required for Proper Synapse Maturation and for Maintenance of Inner and Outer Hair Cells in Mouse Models for DFNB9 Frontiers in Cellular Neuroscience 2021-07-14 [PMID: 34335185] (IF/IHC) | IF/IHC |
Secondary Antibodies |
Isotype Controls |
Research Areas for MYO6 Antibody (H00004646-M02)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MYO6 |
| Uniprot |
|