MYO6 Antibody (2E12)

Images

 
Western Blot: MYO6 Antibody (2E12) [H00004646-M02] - MYO6 monoclonal antibody (M02), clone 2E12. Analysis of MYO6 expression in MCF-7.
Sandwich ELISA: MYO6 Antibody (2E12) [H00004646-M02] - Detection limit for recombinant GST tagged MYO6 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, IHC, S-ELISA
Clone
2E12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MYO6 Antibody (2E12) Summary

Immunogen
MYO6 (NP_004990.2, 1188 a.a. ~ 1285 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KKKGWWYAHFDGPWIARQMELHPDKPPILLVAGKDDMEMCELNLEETGLTRKRGAEILPRQFEEIWERCGGIQYLQNAIESRQARPTYATAMLQSLLK
Specificity
This product is specific for Human MYO6 monoclonal antibody (M02), clone 2E12 [Gene ID: 4646].
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MYO6
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Sandwich ELISA
  • Western Blot
Application Notes
Use in Immunohistochemistry reported in scientific literature (PMID:34335185).
Publications
Read Publication using H00004646-M02.

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:34335185)

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MYO6 Antibody (2E12)

  • DFNA22
  • DFNB37
  • KIAA0389deafness, autosomal recessive 37
  • myosin VI
  • myosin-VI
  • Unconventional myosin-6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-93677
Species: Hu, Mu, Rt
Applications: WB
NB100-1353
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
MAB4470
Species: All-Multi
Applications: ICC, IHC, WB
NBP1-92156
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-15669
Species: Hu, Mu, Rt
Applications: IHC, WB
AF8064
Species: Hu
Applications: ICC, IHC, WB
NBP1-84682
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
H00051168-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
MAB25031
Species: Hu
Applications: IHC, IP, WB
NBP2-19452
Species: Hu
Applications: IHC, IHC-P, WB
AF566
Species: Mu, Rt
Applications: Block, CyTOF-ready, Flow, IHC, WB
NB110-81529
Species: Hu, Mu, Ma-Op, Po, Pm, Rb, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IP, KD, KO, Simple Western, WB
2914-HT
Species: Hu
Applications: BA
NB600-1229
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
NB110-96417
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
H00004646-M02
Species: Hu, Mu
Applications: WB, ELISA, IHC, S-ELISA

Publications for MYO6 Antibody (H00004646-M02)(1)

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
All Species

Reviews for MYO6 Antibody (H00004646-M02) (0)

There are no reviews for MYO6 Antibody (H00004646-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MYO6 Antibody (H00004646-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MYO6 Products

Array H00004646-M02

Bioinformatics Tool for MYO6 Antibody (H00004646-M02)

Discover related pathways, diseases and genes to MYO6 Antibody (H00004646-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MYO6 Antibody (H00004646-M02)

Discover more about diseases related to MYO6 Antibody (H00004646-M02).
 

Pathways for MYO6 Antibody (H00004646-M02)

View related products by pathway.

PTMs for MYO6 Antibody (H00004646-M02)

Learn more about PTMs related to MYO6 Antibody (H00004646-M02).
 

Research Areas for MYO6 Antibody (H00004646-M02)

Find related products by research area.

Blogs on MYO6

There are no specific blogs for MYO6, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MYO6 Antibody (2E12) and receive a gift card or discount.

Bioinformatics

Gene Symbol MYO6
Uniprot