RAB8A Antibody (3G1)

Images

 
Western Blot: RAB8A Antibody (3G1) [H00004218-M02] - RAB8A monoclonal antibody (M02), clone 3G1 Analysis of RAB8A expression in Hela S3 NE.
Immunocytochemistry/ Immunofluorescence: RAB8A Antibody (3G1) [H00004218-M02] - Neuromast hair cells of zebrafish embryos stained with RAB8A antibody. Donkey anti-mouse Alexa Fluor 594 secondary antibody was used. Image ...read more
Immunohistochemistry-Paraffin: RAB8A Antibody (3G1) [H00004218-M02] - Immunoperoxidase of monoclonal antibody to RAB8A on formalin-fixed paraffin-embedded human lymphoma. [antibody concentration 3 ug/ml]

Product Details

Summary
Reactivity Hu, ZeSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
3G1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RAB8A Antibody (3G1) Summary

Immunogen
RAB8A (AAH02977, 108 a.a. - 207 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL
Localization
Cell membrane; Lipid-anchor; Cytoplasmic side
Specificity
RAB8A - RAB8A, member RAS oncogene family
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RAB8A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
Control
RAB8A Lysate (NBP2-64934)
Reviewed Applications
Read 1 Review rated 5
using
H00004218-M02 in the following applications:

Publications
Read Publications using
H00004218-M02 in the following applications:

Reactivity Notes

Zebrafish reactivity reported in scientific literature (PMID: 29281629).

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RAB8A Antibody (3G1)

  • mel transforming oncogene (derived from cell line NK14)- RAB8 homolog
  • mel transforming oncogene (derived from cell line NK14)
  • MELras-associated protein RAB8
  • Oncogene c-mel
  • RAB8A, member RAS oncogene family
  • RAB8mel transforming oncogene (RAB8 homolog)
  • ras-related protein Rab-8A

Background

The protein encoded by this gene is a member of the RAS superfamily which are small GTP/GDP-binding proteins with an average size of 200 amino acids. The RAS-related proteins of the RAB/YPT family may play a role in the transport of proteins from the endoplasmic reticulum to the Golgi and the plasma membrane. This protein shares 97%, 96%, and 51% similarity with the dog RAB8, mouse MEL, and mouse YPT1 proteins, respectively and contains the 4 GTP/GDP-binding sites that are present in all the RAS proteins. The putative effector-binding site of this protein is similar to that of the RAB/YPT proteins. However, this protein contains a C-terminal CAAX motif that is characteristic of many RAS superfamily members but which is not found in YPT1 and the majority of RAB proteins. Although this gene was isolated as a transforming gene from a melanoma cell line, no linkage between MEL and malignant melanoma has been demonstrable. This oncogene is located 800 kb distal to MY09B on chromosome 19p13.1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-49320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02142
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84682
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-33110
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-51634
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
H00005873-M02
Species: Hu
Applications: WB, ELISA, IHC-P, RNAi
H00117177-B01P
Species: Hu, Ze
Applications: WB, ChIP, ELISA
H00005864-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP1-55113
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB120-13253
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-25159
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP2-57641
Species: Hu
Applications: WB, ICC/IF
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP1-47492
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-14081
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for RAB8A Antibody (H00004218-M02)(4)

Review for RAB8A Antibody (H00004218-M02) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Other.

Reviews using H00004218-M02:
Filter by Applications
IF
(1)
All Applications
Filter by Species
Other
(1)
All Species
Images Ratings Applications Species Date Details
Immunofluorescence RAB8A H00004218-M02
Enlarge
reviewed by:
Anonymous
IF Other 05/12/2016
View

Summary

ApplicationImmunofluorescence
Sample Testedneuromast hair cells
SpeciesOther

Blocking

Blocking DetailsBlocking: PBS containing 0.1%DMSO + 2.5% Tween-20 + 6%FCS + 3%BSA, 1 hour at room temperature

Primary Anitbody

Dilution RatioDilution 1:100 in blocking solution. Incaubation overnight at 4C

Secondary Antibody

Secondary Descriptiondonkey anti-mouse Alexa-Fluor 594
Secondary Manufacturer Cat#Invitrogen
Secondary Concentration1:200 in blocking solution

Details

Detection NotesConfocal micorscopy
Fixation DetailsFixation 4% PFA in PBS containing 4% sucrose and 0.01% Tween-20 overnigth at 4C.
Wash DescriptionWash 3 times 10 minutes each in PBSDTw (PBS + 0.1% DMSO + 0.01% Tween-20)

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RAB8A Antibody (H00004218-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for RAB8A Antibody (H00004218-M02)

Discover related pathways, diseases and genes to RAB8A Antibody (H00004218-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB8A Antibody (H00004218-M02)

Discover more about diseases related to RAB8A Antibody (H00004218-M02).
 

Pathways for RAB8A Antibody (H00004218-M02)

View related products by pathway.

PTMs for RAB8A Antibody (H00004218-M02)

Learn more about PTMs related to RAB8A Antibody (H00004218-M02).

Blogs on RAB8A

There are no specific blogs for RAB8A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
05/12/2016
Application: IF
Species: Other

Bioinformatics

Gene Symbol RAB8A
Entrez
OMIM
Uniprot