RAB8A Antibody (3G1)

Western Blot: RAB8A Antibody (3G1) [H00004218-M02] - RAB8A monoclonal antibody (M02), clone 3G1 Analysis of RAB8A expression in Hela S3 NE.

Immunocytochemistry/Immunofluorescence: RAB8A Antibody (3G1) [H00004218-M02] - Neuromast hair cells of zebrafish embryos stained with RAB8A antibody. Donkey anti-mouse Alexa Fluor 594 secondary antibody was used. Image from verified customer.

Immunohistochemistry-Paraffin: RAB8A Antibody (3G1) [H00004218-M02] - Immunoperoxidase of monoclonal antibody to RAB8A on formalin-fixed paraffin-embedded human lymphoma. [antibody concentration 3 ug/ml]

• Reactivity: Hu, Ze
• Applications: WB, ELISA, ICC/IF, IHC-P
• Clone: 3G1
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

RAB8A Antibody (3G1) Summary

• Immunogen: RAB8A (AAH02977, 108 a.a. - 207 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL
• Localization: Cell membrane; Lipid-anchor; Cytoplasmic side
• Specificity: RAB8A - RAB8A, member RAS oncogene family
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: RAB8A
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
• Control:

  RAB8A Lysate (NBP2-64934)

Reactivity Notes

Zebrafish reactivity reported in scientific literature (PMID: 29281629).

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RAB8A Antibody (3G1)

• mel transforming oncogene (derived from cell line NK14)- RAB8 homolog
• mel transforming oncogene (derived from cell line NK14)
• MELras-associated protein RAB8
• Oncogene c-mel
• RAB8A, member RAS oncogene family
• RAB8mel transforming oncogene (RAB8 homolog)
• ras-related protein Rab-8A

Background

The protein encoded by this gene is a member of the RAS superfamily which are small GTP/GDP-binding proteins with an average size of 200 amino acids. The RAS-related proteins of the RAB/YPT family may play a role in the transport of proteins from the endoplasmic reticulum to the Golgi and the plasma membrane. This protein shares 97%, 96%, and 51% similarity with the dog RAB8, mouse MEL, and mouse YPT1 proteins, respectively and contains the 4 GTP/GDP-binding sites that are present in all the RAS proteins. The putative effector-binding site of this protein is similar to that of the RAB/YPT proteins. However, this protein contains a C-terminal CAAX motif that is characteristic of many RAS superfamily members but which is not found in YPT1 and the majority of RAB proteins. Although this gene was isolated as a transforming gene from a melanoma cell line, no linkage between MEL and malignant melanoma has been demonstrable. This oncogene is located 800 kb distal to MY09B on chromosome 19p13.1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RAB8A Antibody (H00004218-M02)(4)

Publications using H00004218-M02

• Ojeda Naharros I, Gesemann M, Mateos JM et al. Loss-of-function of the ciliopathy protein Cc2d2a disorganizes the vesicle fusion machinery at the periciliary membrane and indirectly affects Rab8-trafficking in zebrafish photoreceptors PLoS Genet. 2017 Dec 01 [PMID: 29281629] (ICC/IF, Zebrafish)
• Stone R, Hayashi T, Bajimaya S et al. Critical role of Rab11a-mediated recycling endosomes in the assembly of type I parainfluenza viruses. Virology. 2015 Oct 17 [PMID: 26484934]
• Hampson A, O'Connor A, Smolenski A. Synaptotagmin-like protein 4 and Rab8 interact and increase dense granule release in platelets. J Thromb Haemost. 2013 Jan [PMID: 23140275] (Human)
• Hsiao Y-C, Tong ZJ, Westfall JE et al. Ahi1, whose human ortholog is mutated in Joubert syndrome, is required for Rab8a localization, ciliogenesis and vesicle trafficking. Hum Mol Genet;18(20):3926-3941. 2009 [PMID: 19625297]

Review for RAB8A Antibody (H00004218-M02) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Other.

reviewed by: Anonymous IF Other 05/12/2016

Summary

• Application: Immunofluorescence
• Sample Tested: neuromast hair cells
• Species: Other

Blocking

• Blocking Details: Blocking: PBS containing 0.1%DMSO + 2.5% Tween-20 + 6%FCS + 3%BSA, 1 hour at room temperature

Primary Anitbody

• Dilution Ratio: Dilution 1:100 in blocking solution. Incaubation overnight at 4C

Secondary Antibody

• Secondary Description: donkey anti-mouse Alexa-Fluor 594
• Secondary Manufacturer Cat#: Invitrogen
• Secondary Concentration: 1:200 in blocking solution

Details

• Detection Notes: Confocal micorscopy
• Fixation Details: Fixation 4% PFA in PBS containing 4% sucrose and 0.01% Tween-20 overnigth at 4C.
• Wash Description: Wash 3 times 10 minutes each in PBSDTw (PBS + 0.1% DMSO + 0.01% Tween-20)

Bioinformatics

• Gene Symbol: RAB8A
• Entrez:
  • 4218(Human)
• OMIM:
  • 165040(Human)
• Uniprot:
  • AAH02977(Human)