Home » RAB8A » RAB8A Antibodies » RAB8A Antibody (3G1)

RAB8A Antibody (3G1)

 (9 Publications)
 (1 Review)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: RAB8A Antibody (3G1) [H00004218-M02] - RAB8A monoclonal antibody (M02), clone 3G1 Analysis of RAB8A expression in Hela S3 NE.
Western Blot: RAB8A Antibody (3G1) [H00004218-M02] - RAB8A monoclonal antibody (M02), clone 3G1 Analysis of RAB8A expression in Hela S3 NE.
Immunocytochemistry/ Immunofluorescence: RAB8A Antibody (3G1) [H00004218-M02] - Neuromast hair cells of zebrafish embryos stained with RAB8A antibody. Donkey anti-mouse Alexa Fluor 594 secondary antibody was used. Image ...read more
ELISA: RAB8A Antibody (3G1) [H00004218-M02] - Detection limit for recombinant GST tagged RAB8A is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, ZeSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC
Clone
3G1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

RAB8A Antibody (3G1) Summary

Immunogen
RAB8A (AAH02977, 108 a.a. ~ 207 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL
Localization
Cell membrane; Lipid-anchor; Cytoplasmic side
Specificity
RAB8A - RAB8A, member RAS oncogene family
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RAB8A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Western Blot 1:500
Application Notes
Use in Immunohistochemistry reported in scientific literature (PMID:34244442).
Reviewed Applications
Read 1 Review rated 5
using
H00004218-M02 in the following applications:
Publications
Read Publications using
H00004218-M02 in the following applications:

Reactivity Notes

Zebrafish reactivity reported in scientific literature (PMID: 29281629).

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RAB8A Antibody (3G1)

  • mel transforming oncogene (derived from cell line NK14)- RAB8 homolog
  • mel transforming oncogene (derived from cell line NK14)
  • MEL
  • MELras-associated protein RAB8
  • Oncogene c-mel
  • RAB8
  • RAB8A
  • RAB8A, member RAS oncogene family
  • RAB8mel transforming oncogene (RAB8 homolog)
  • ras-related protein Rab-8A

Background

The protein encoded by this gene is a member of the RAS superfamily which are small GTP/GDP-binding proteins with an average size of 200 amino acids. The RAS-related proteins of the RAB/YPT family may play a role in the transport of proteins from the endoplasmic reticulum to the Golgi and the plasma membrane. This protein shares 97%, 96%, and 51% similarity with the dog RAB8, mouse MEL, and mouse YPT1 proteins, respectively and contains the 4 GTP/GDP-binding sites that are present in all the RAS proteins. The putative effector-binding site of this protein is similar to that of the RAB/YPT proteins. However, this protein contains a C-terminal CAAX motif that is characteristic of many RAS superfamily members but which is not found in YPT1 and the majority of RAB proteins. Although this gene was isolated as a transforming gene from a melanoma cell line, no linkage between MEL and malignant melanoma has been demonstrable. This oncogene is located 800 kb distal to MY09B on chromosome 19p13.1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Rab11A Antibody
NBP2-49320
Western Blot: Rab11A Antibody [NBP2-49320] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissueLane 6: Human Tonsil tissue
Immunohistochemistry-Paraffin: Rab11A Antibody [NBP2-49320] - Staining of human colon shows moderate positivity in glandular cells.
Immunohistochemistry-Paraffin: Rab11A Antibody [NBP2-49320] - Staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.
(2 Reviews)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Prolactin Antibody
[Unconjugated]
AF682
Recombinant Human Prolactin (Catalog # 682-PL) stimulates proliferation in the Nb2‑11 rat lymphoma cell line in a dose-dependent manner (orange line). Proliferation elicited by Recombinant Human Prolactin (0.5 ng/mL) is neutralized (green line) by increasing concentrations of Goat Anti-Human Prolactin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF682). The ND50 is typically 0.02-0.05 µg/mL.
Prolactin was detected in immersion fixed paraffin-embedded sections of human testis using Goat Anti-Human Prolactin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF682) at 1 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm of sperm cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of human pituitary tissue. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Human Prolactin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF682) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Prolactin at approximately 23 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(6 Publications)
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, WB
Optineurin Antibody
NBP1-84682
Western Blot: Optineurin Antibody [NBP1-84682] - Analysis in human cell lines A-431 and PC-3. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.
Western Blot: Optineurin Antibody [NBP1-84682] - Effect of mitochondrial fission protein, Drp1 (FL) and mutant Tau on Optineurin expression in N2a (M) cells. Lanes: M. Ladder M. Ladder 1. N2a cells 2. N2a cells + mutant Tau 3. N2a cells + mutant tau + Drp1 full length + mutant Tau. This image was submitted via customer review.
Western Blot: Optineurin Antibody [NBP1-84682] - Analysis using Anti-OPTN antibody NBP1-84682 (A) shows similar pattern to independent antibody NBP1-84683 (B).
(2 Reviews)
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
RAB6A Antibody
NBP1-33110
Immunocytochemistry/Immunofluorescence: RAB6A Antibody [NBP1-33110] - A549 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: RAB6A protein stained by RAB6A antibody diluted at 1:500. Blue: Hoechst 33342 staining. Scale bar = 10 um.
Western Blot: RAB6A Antibody [NBP1-33110] - A. 30 ug A549 whole cell lysate/extract B. 30 ug H1299 whole cell lysate/extract C. 30 ug HCT116 whole cell lysate/extract 12 % SDS-PAGE RAB6A antibody dilution: 1:1000
Knockout Validated: RAB6A Antibody [NBP1-33110] - Wild-type (WT) and RAB6A knockout (KO) 293T cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with RAB6A antibody diluted at 1:500. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
HIV-1 Rev binding
protein Antibody
NBP1-91991
Immunocytochemistry/Immunofluorescence: HIV-1 Rev binding protein Antibody [NBP1-91991] - Immunofluorescent staining of human cell line A-431 shows localization to vesicles.
Western Blot: HIV-1 Rev binding protein Antibody [NBP1-91991] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: HIV-1 Rev binding protein Antibody [NBP1-91991] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Catalase Antibody
[Unconjugated]
AF3398
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, Raji human Burkitt's lymphoma cell line, HeLa human cervical epithelial carcinoma cell line, NIH‑3T3 mouse embryonic fibroblast cell line, A20 mouse B cell lymphoma cell line, andRat‑2 rat embryonic fibroblast cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti‑Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Catalase at approximately 64 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 2. 
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line and Raji human Burkitt's lymphoma cell line, loaded at 0.2 mg/mL. A specific band was detected for Catalase at approximately 62 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and Catalase knockout HeLa cell line (KO). PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Catalase at approximately 64 kDa (as indicated) in the parental HeLa cell line, but is not detectable in knockout HeLa cell line. GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(7 Reviews)
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
RAB10 Antibody
(4E2)
NBP1-51634
Immunocytochemistry/Immunofluorescence: RAB10 Antibody (4E2) [NBP1-51634] - Immunofluorescence analysis of LOVO cells using Rab10 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye.
Western Blot: RAB10 Antibody (4E2) [NBP1-51634] - Analysis using Rab10 mouse mAb against Hela (1) and NIH/3T3 (2) cell lysate.
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
Rab27a Antibody
(1G7)
H00005873-M02
Western Blot: Rab27a Antibody (1G7) [H00005873-M02] - Analysis of RAB27A expression in transfected 293T cell line by RAB27A monoclonal antibody (M02), clone 1G7.Lane 1: RAB27A transfected lysate(24.9 KDa).Lane 2: Non-transfected lysate.
Immunohistochemistry-Paraffin: Rab27a Antibody (1G7) [H00005873-M02] - Analysis of monoclonal antibody to RAB27A on formalin-fixed paraffin-embedded human lymphoma. Antibody concentration 3 ug/ml.
Western Blot: Rab27a Antibody (1G7) [H00005873-M02] - Analysis of RAB27A over-expressed 293 cell line, cotransfected with RAB27A Validated Chimera RNAi ( Cat # H00005873-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with RAB27A monoclonal antibody (M02), clone 1G7 (Cat # H00005873-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
(12 Publications)
Species: Hu, Mu, Rb
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, S-ELISA, WB
RAB3IP Antibody
(OTI5F2)
NBP2-45500
Immunocytochemistry/Immunofluorescence: RAB3IP Antibody (OTI5F2) [NBP2-45500] - RAB3IP Antibody (5F2) [NBP2-45500] - 3dpf zebrafish neuromast immunostained for Rab3IP (red) and counterstained with phalloidin (green). Image courtesy of customer.
Immunohistochemistry-Paraffin: RAB3IP Antibody (OTI5F2) [NBP2-45500] - Staining of paraffin-embedded Carcinoma of Human liver tissue using anti-RAB3IP mouse monoclonal antibody. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3min) (1:150)
Immunohistochemistry-Paraffin: RAB3IP Antibody (OTI5F2) [NBP2-45500] - Staining of paraffin-embedded Carcinoma of Human pancreas tissue using anti-RAB3IP mouse monoclonal antibody. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3min) (1:150)
(1 Review)
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Rab3A Antibody
(OTI1G3)
NBP2-45499
Western Blot: Rab3A Antibody (OTI1G3) [NBP2-45499] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY RAB3A (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-RAB3A.
Immunohistochemistry-Paraffin: Rab3A Antibody (OTI1G3) [NBP2-45499] - Staining of paraffin-embedded Carcinoma of Human kidney tissue using anti-RAB3A mouse monoclonal antibody.
Immunohistochemistry-Paraffin: Rab3A Antibody (OTI1G3) [NBP2-45499] - Staining of paraffin-embedded Carcinoma of Human liver tissue using anti-RAB3A mouse monoclonal antibody.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
POMC Antibody
NB100-1533
Western Blot: POMC Antibody [NB100-1533] - Staining of NIH3T3 cell lysate with antibody at 0.3 ug/mL (A) and Rat Brain cell lysate with antibody at 2 ug/mL (B). 35 ug protein in RIPA buffer. Detected by chemiluminescence.
Flow Cytometry: POMC Antibody [NB100-1533] - Flow cytometric analysis of paraformaldehyde fixed A431 cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
Immunohistochemistry: POMC Antibody [NB100-1533] - Representative immunofluorescence images of (B) POMC as a prohormone (n = 5-6 each) in the ARC of mice approximately 5 to 10 weeks of age. Image collected and cropped by CiteAb from the following publication (jci.org/articles/view/96420), licensed under a CC-BY licence.
(10 Publications)
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Thyroglobulin
Antibody (2H11 + 6E1)
NBP2-34294
Immunohistochemistry-Paraffin: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Analysis using Azide/BSA FREE version of NBP2-34294. Human Thyroid stained with Thyroglobulin Ab (2H11 + 6E1).
Immunohistochemistry: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Imaging of Mouse stomach tissue. Positive staining can only be observed inside the thyroid cells and the follicle in thyroid tissue. This image was submitted via customer Review.
Immunohistochemistry-Paraffin: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Thyroglobulin staining in thyroid tissue of normal C57 mouse (Red). Dilution is 1:100. IHC-P image submitted by a verified customer review.
(3 Reviews)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Rab1A Antibody
NBP1-55113
Western Blot: Rab1A Antibody [NBP1-55113] - HeLa, Vera, HeLa transfected with mouse construct, Antibody Titration: 0.2-1 ug/ml
Western Blot: Rab1A Antibody [NBP1-55113] - Analysis of HepG2 cell lysate. Antibody Dilution: 1.0 ug/ml.
Immunohistochemistry: Rab1A Antibody [NBP1-55113] - Formalin Fixed Paraffin Embedded Human Bronchial Epithelial Tissue. Observed Staining: Cytoplasmic staining with Primary Antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec.
Species: Hu, Pm, Mu
Applications: IHC, IHC-P, WB
Rab5a Antibody
NB120-13253
Western Blot: Rab5a Antibody [NB120-13253] - Western blot analysis of Human Cell line lysates showing detection of Rab5aprotein using Rabbit Anti-Rab5aPolyclonal Antibody (NB120-13253). Load: 15 ugprotein. Block: 1.5% BSA for 30 minutes at RT. Primary Antibody: Rabbit Anti-Rab5aPolyclonal Antibody (NB120-13253) at 1:1000 for 2 hours at RT. Secondary Antibody: Donkey Anti-Rabbit IgG: HRP for 1 hour at RT.
Immunohistochemistry: Rab5a Antibody [NB120-13253] - Immunohistochemistry analysis using Rabbit Anti-Rab5aPolyclonal Antibody (NB120-13253). Tissue: backskin. Species: Mouse. Fixation: Bouin's Fixative Solution. Primary Antibody: Rabbit Anti-Rab5aPolyclonal Antibody (NB120-13253) at 1:100 for 1 hour at RT. Secondary Antibody: FITC Goat Anti-Rabbit (green) at 1:50 for 1 hour at RT. Localization: Cytoplasm.
Immunohistochemistry-Paraffin: Rab5a Antibody [NB120-13253] - analysis using Rabbit Anti-Rab5 Polyclonal Antibody . Tissue: backskin. Species: Mouse. Fixation: Bouins Fixative Solution. Primary Antibody: Rabbit Anti-Rab5 Polyclonal Antibody at 1:100 for 1 hour at RT. Secondary Antibody: FITC Goat Anti-Rabbit (green) at 1:50 for 1 hour at RT. Localization: Cytoplasm.
(2 Reviews)
(14 Publications)
Species: Bv, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P, IP, WB
Rhodopsin Antibody
(4D2)
NBP2-59690
Immunohistochemistry-Frozen: Rhodopsin Antibody (4D2) [NBP2-59690] - Zebrafish retina (outer nuclear layer). PFA and methanol fixed 7 um sections. Rhodopsin antibody O/N incubation at 1:500. IHC-Fr image submitted by a verified customer review.
Western Blot: Rhodopsin Antibody (4D2) [NBP2-59690] - Western Blot analysis of Bovine photoreceptor membranes showing detection of Rhodopsin protein using Mouse Anti-Rhodopsin Monoclonal Antibody, Clone 4D2 (NBP2-59690). Lane 1: MW ladder. Lane 2: 10 ug. Lane 3: 5 ug. Lane 4: 2.5 ug.. Primary Antibody: Mouse Anti-Rhodopsin Monoclonal Antibody (NBP2-59690) at 1:1000.
Immunohistochemistry: Rhodopsin Antibody (4D2) [NBP2-59690] - Immunohistochemistry analysis using Mouse Anti-Rhodopsin Monoclonal Antibody, Clone 4D2 (NBP2-59690). Tissue: retina. Species: Mouse. Primary Antibody: Mouse Anti-Rhodopsin Monoclonal Antibody (NBP2-59690) at 1:1000. Secondary Antibody: FITC Goat Anti-Mouse (green). Counterstain: DAPI (blue) nuclear stain. Localization: Staining of photoreceptor outer segment (OS). Other layers of the retina: IS inner segment; ONL outer nuclear layer; OPL outer plexiform layer; INL inner nuclear layer; IPL inner plexiform layer; GCL ganglion cell layer..
(1 Review)
(3 Publications)
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
RAB8B Antibody
NBP1-69095
Western Blot: RAB8B Antibody [NBP1-69095] - 1. Human Cervical Cancer Cell lysate (15ug) 2. Monkey Fibroblast Cell lysate (15ug) 3. Human Cervical Cancer Cell transfected with mouse Rab8B-GFP (15ug) Primary Dilution: 1 : 1000 Secondary Antibody: goat anti-Rabbit Secondary Dilution: 1 : 40,000.
Western Blot: RAB8B Antibody [NBP1-69095] - HepG2 Cell Lysate 1ug/ml Gel Concentration 12%
Species: Hu, Pm, Mu
Applications: WB
Glut4 Antibody -
BSA Free
NBP1-49533
Flow (Intracellular): Glut4 Antibody [NBP1-49533] - An intracellular stain was performed on HepG2 with NBP1-49533 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody.
Western Blot: Glut4 Antibody [NBP1-49533] - Total protein from 3T3-L1 mouse embryonic fibroblast adipose-like cell line, separated by 4-12% SDS-PAGE, transferred to nitrocellulose membrane and blocked in 5% non-fat milk for 1h at room temperature. The membrane was probed with anti-Glut4 0.5 ug/ml in non-fat milk. Undiffer: undifferentiated; Differ: Differentiated. Image from verified customer review.
Western Blot: Glut4 Antibody [NBP1-49533] - Glycolysis-related genes and proteins were upregulated in differentiated podocytes. Representative blot images of glycolysis-related proteins (n =3). d All proteins were normalized to tubulin and compared to UDPs. *P < 0.05, **P < 0.01, determined by t test. Data are shown as the means +/- SD. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41419-020-2481-5), licensed under a CC-BY licence.
(4 Reviews)
(25 Publications)
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
GATA-1 Antibody
(4F5)
NBP1-47492
Immunohistochemistry: GATA-1 Antibody (4F5) [NBP1-47492] - Staining of Fetal Baboon Liver. Antigen retrieval: 10mM sodium citrate, pH 6.0, Primary Ab: 1:500 dilution, Secondary Ab (biotinylated): 1:200, Streptavidin-AlexaFluor488: 1:500 (green), Quench autofluorescence with 1% Sudan Black in 70% methanol. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: GATA-1 Antibody (4F5) [NBP1-47492] - Analysis of K562(left) cells using GATA1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye.
Immunohistochemistry-Paraffin: GATA-1 Antibody (4F5) [NBP1-47492] - Analysis of pancreatic cancer, using GATA1 mouse mAb with DAB staining.
(1 Review)
(2 Publications)
Species: Pm, Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
PBX1 Antibody (4A2)
H00005087-M01
Western Blot: PBX1 Antibody (4A2) [H00005087-M01] - PBX1 monoclonal antibody (M01), clone 4A2 Analysis of PBX1 expression in Hela S3 NE.
Immunocytochemistry/Immunofluorescence: PBX1 Antibody (4A2) [H00005087-M01] - Analysis of monoclonal antibody to PBX1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: PBX1 Antibody (4A2) [H00005087-M01] - Analysis of monoclonal antibody to PBX1 on formalin-fixed paraffin-embedded human salivary gland. Antibody concentration 3 ug/ml.
(9 Publications)
Species: Hu, Pm, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Hemoglobin beta
Antibody
NBP2-14081
Immunocytochemistry/Immunofluorescence: Hemoglobin beta Antibody [NBP2-14081] - Staining of human cell line Hep G2 shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Hemoglobin beta Antibody [NBP2-14081] - Staining of human placenta shows erythrocyte positivity in vessels.
(1 Review)
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for RAB8A Antibody (H00004218-M02)(9)

We have publications tested in 2 confirmed species: Human, Zebrafish.

We have publications tested in 2 applications: ICC/IF, IHC.


Filter By Application
ICC/IF
(2)
IHC
(1)
All Applications
Filter By Species
Human
(1)
Zebrafish
(3)
All Species
Showing Publications 1 - 9 of 9.
Publications using H00004218-M02 Applications Species
Nichols E, Smith C, Synaptic-like Vesicles Facilitate Pioneer Axon Invasion Current Biology Aug 1 2019 [PMID: 31378609] (Zebrafish) Zebrafish
Barny I, Perrault I, Michel C et al. Basal exon skipping and nonsense-associated altered splicing allows bypassing complete CEP290 loss-of-function in individuals with unusually mild retinal disease. Hum Mol Genet May 16 2018 [PMID: 29771326]
Ojeda Naharros I, Gesemann M, Mateos JM et al. Loss-of-function of the ciliopathy protein Cc2d2a disorganizes the vesicle fusion machinery at the periciliary membrane and indirectly affects Rab8-trafficking in zebrafish photoreceptors PLoS Genet. 2017 Dec 01 [PMID: 29281629] (ICC/IF, Zebrafish) ICC/IF Zebrafish
Goodman L, Zallocchi M Integrin alpha 8 and Pcdh15 act as a complex to regulate cilia biogenesis in sensory cells J Cell Sci. 2017 Oct 31 [PMID: 28883094] (ICC/IF, Zebrafish) ICC/IF Zebrafish
Stone R, Hayashi T, Bajimaya S et al. Critical role of Rab11a-mediated recycling endosomes in the assembly of type I parainfluenza viruses. Virology. 2015 Oct 17 [PMID: 26484934]
Hampson A, O'Connor A, Smolenski A. Synaptotagmin-like protein 4 and Rab8 interact and increase dense granule release in platelets. J Thromb Haemost. 2013 Jan [PMID: 23140275] (Human) Human
Leventea E, Zhu Z, Fang X Et Al. Ciliopathy genes are required for apical secretion of Cochlin, an otolith crystallization factor Proceedings of the National Academy of Sciences of the United States of America Jul 13 2021 [PMID: 34244442] (IHC) IHC
Hsiao Y-C, Tong ZJ, Westfall JE et al. Ahi1, whose human ortholog is mutated in Joubert syndrome, is required for Rab8a localization, ciliogenesis and vesicle trafficking. Hum Mol Genet;18(20):3926-3941. 2009 [PMID: 19625297]

Review for RAB8A Antibody (H00004218-M02) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Other.

Reviews using H00004218-M02:
Filter by Applications
Immunofluorescence
(1)
All Applications
Filter by Species
Other
(1)
All Species
Images Ratings Applications Species Date Details
Immunofluorescence RAB8A H00004218-M02
Enlarge 		5
reviewed by:
Marisa Zallocchi
 Immunofluorescence Other 05/12/2016
View

Summary

ApplicationImmunofluorescence
Sample Testedneuromast hair cells
SpeciesOther

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RAB8A Antibody (H00004218-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAB8A Products

Bioinformatics Tool for RAB8A Antibody (H00004218-M02)

Discover related pathways, diseases and genes to RAB8A Antibody (H00004218-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB8A Antibody (H00004218-M02)

Discover more about diseases related to RAB8A Antibody (H00004218-M02).
 

Pathways for RAB8A Antibody (H00004218-M02)

View related products by pathway.

PTMs for RAB8A Antibody (H00004218-M02)

Learn more about PTMs related to RAB8A Antibody (H00004218-M02).
 

Research Areas for RAB8A Antibody (H00004218-M02)

Find related products by research area.

Blogs on RAB8A

There are no specific blogs for RAB8A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0
Immunofluorescence RAB8A H00004218-M02
Enlarge
 Marisa Zallocchi
05/12/2016
Application: Immunofluorescence
Species: Other
read this review

Bioinformatics

Gene Symbol RAB8A
Entrez
OMIM
Uniprot