RAB8A Antibody (3G1) - Azide and BSA Free

Western Blot: RAB8A Antibody (3G1) [H00004218-M02] - RAB8A monoclonal antibody (M02), clone 3G1 Analysis of RAB8A expression in Hela S3 NE.

Immunocytochemistry/Immunofluorescence: RAB8A Antibody (3G1) [H00004218-M02] - Neuromast hair cells of zebrafish embryos stained with RAB8A antibody. Donkey anti-mouse Alexa Fluor 594 secondary antibody was used. Image from verified customer.

ELISA: RAB8A Antibody (3G1) [H00004218-M02] - Detection limit for recombinant GST tagged RAB8A is approximately 0.1ng/ml as a capture antibody.

• Reactivity: Hu, Mu, Ze
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 3G1
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

RAB8A Antibody (3G1) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: RAB8A (AAH02977, 108 a.a. ~ 207 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL
• Localization: Cell membrane; Lipid-anchor; Cytoplasmic side
• Specificity: RAB8A - RAB8A, member RAS oncogene family
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: RAB8A
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Western Blot 1:500
• Application Notes: Use in Immunohistochemistry reported in scientific literature (PMID:34244442).

Reactivity Notes

Zebrafish reactivity reported in scientific literature (PMID: 29281629).

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RAB8A Antibody (3G1) - Azide and BSA Free

• mel transforming oncogene (derived from cell line NK14)- RAB8 homolog
• mel transforming oncogene (derived from cell line NK14)
• MEL
• MELras-associated protein RAB8
• Oncogene c-mel
• RAB8
• RAB8A
• RAB8A, member RAS oncogene family
• RAB8mel transforming oncogene (RAB8 homolog)
• ras-related protein Rab-8A

Background

The protein encoded by this gene is a member of the RAS superfamily which are small GTP/GDP-binding proteins with an average size of 200 amino acids. The RAS-related proteins of the RAB/YPT family may play a role in the transport of proteins from the endoplasmic reticulum to the Golgi and the plasma membrane. This protein shares 97%, 96%, and 51% similarity with the dog RAB8, mouse MEL, and mouse YPT1 proteins, respectively and contains the 4 GTP/GDP-binding sites that are present in all the RAS proteins. The putative effector-binding site of this protein is similar to that of the RAB/YPT proteins. However, this protein contains a C-terminal CAAX motif that is characteristic of many RAS superfamily members but which is not found in YPT1 and the majority of RAB proteins. Although this gene was isolated as a transforming gene from a melanoma cell line, no linkage between MEL and malignant melanoma has been demonstrable. This oncogene is located 800 kb distal to MY09B on chromosome 19p13.1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RAB8A Antibody (H00004218-M02)(9)

Publications using H00004218-M02

• Nichols E, Smith C, Synaptic-like Vesicles Facilitate Pioneer Axon Invasion Current Biology 2019-08-01 [PMID: 31378609] (Zebrafish)
• Barny I, Perrault I, Michel C et al. Basal exon skipping and nonsense-associated altered splicing allows bypassing complete CEP290 loss-of-function in individuals with unusually mild retinal disease. Hum Mol Genet 2018-05-16 [PMID: 29771326]
• Ojeda Naharros I, Gesemann M, Mateos JM et al. Loss-of-function of the ciliopathy protein Cc2d2a disorganizes the vesicle fusion machinery at the periciliary membrane and indirectly affects Rab8-trafficking in zebrafish photoreceptors PLoS Genet. 2017-12-01 [PMID: 29281629] (ICC/IF, Zebrafish)
• Goodman L, Zallocchi M Integrin alpha 8 and Pcdh15 act as a complex to regulate cilia biogenesis in sensory cells J Cell Sci. 2017-10-31 [PMID: 28883094] (ICC/IF, Zebrafish)
• Stone R, Hayashi T, Bajimaya S et al. Critical role of Rab11a-mediated recycling endosomes in the assembly of type I parainfluenza viruses. Virology. 2015-10-17 [PMID: 26484934]
• Hampson A, O'Connor A, Smolenski A. Synaptotagmin-like protein 4 and Rab8 interact and increase dense granule release in platelets. J Thromb Haemost. 2013-01-01 [PMID: 23140275] (Human)
• Leventea E, Zhu Z, Fang X Et Al. Ciliopathy genes are required for apical secretion of Cochlin, an otolith crystallization factor Proceedings of the National Academy of Sciences of the United States of America 2021-07-13 [PMID: 34244442] (IF/IHC)
• Hsiao Y-C, Tong ZJ, Westfall JE et al. Ahi1, whose human ortholog is mutated in Joubert syndrome, is required for Rab8a localization, ciliogenesis and vesicle trafficking. Hum Mol Genet;18(20):3926-3941. 2009-01-01 [PMID: 19625297]

Review for RAB8A Antibody (H00004218-M02) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Other.

reviewed by: Verified Customer IF Other 05/12/2016

Summary

• Application: Immunofluorescence
• Sample Tested: neuromast hair cells
• Species: Other

Bioinformatics

• Gene Symbol: RAB8A
• Entrez:
  • 4218(Human)
• OMIM:
  • 165040(Human)
• Uniprot:
  • AAH02977(Human)