RAB8A Antibody (3G1)

Images

 
Western Blot: RAB8A Antibody (3G1) [H00004218-M02] - RAB8A monoclonal antibody (M02), clone 3G1 Analysis of RAB8A expression in Hela S3 NE.
Immunocytochemistry/ Immunofluorescence: RAB8A Antibody (3G1) [H00004218-M02] - Neuromast hair cells of zebrafish embryos stained with RAB8A antibody. Donkey anti-mouse Alexa Fluor 594 secondary antibody was used. Image ...read more
ELISA: RAB8A Antibody (3G1) [H00004218-M02] - Detection limit for recombinant GST tagged RAB8A is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, ZeSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
3G1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RAB8A Antibody (3G1) Summary

Immunogen
RAB8A (AAH02977, 108 a.a. ~ 207 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL
Localization
Cell membrane; Lipid-anchor; Cytoplasmic side
Specificity
RAB8A - RAB8A, member RAS oncogene family
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RAB8A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Control
RAB8A Knockout HeLa Cell Lysate
Reviewed Applications
Read 1 Review rated 5
using
H00004218-M02 in the following applications:

Publications
Read Publications using
H00004218-M02 in the following applications:

Reactivity Notes

Zebrafish reactivity reported in scientific literature (PMID: 29281629).

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RAB8A Antibody (3G1)

  • mel transforming oncogene (derived from cell line NK14)- RAB8 homolog
  • mel transforming oncogene (derived from cell line NK14)
  • MELras-associated protein RAB8
  • Oncogene c-mel
  • RAB8A, member RAS oncogene family
  • RAB8mel transforming oncogene (RAB8 homolog)
  • ras-related protein Rab-8A

Background

The protein encoded by this gene is a member of the RAS superfamily which are small GTP/GDP-binding proteins with an average size of 200 amino acids. The RAS-related proteins of the RAB/YPT family may play a role in the transport of proteins from the endoplasmic reticulum to the Golgi and the plasma membrane. This protein shares 97%, 96%, and 51% similarity with the dog RAB8, mouse MEL, and mouse YPT1 proteins, respectively and contains the 4 GTP/GDP-binding sites that are present in all the RAS proteins. The putative effector-binding site of this protein is similar to that of the RAB/YPT proteins. However, this protein contains a C-terminal CAAX motif that is characteristic of many RAS superfamily members but which is not found in YPT1 and the majority of RAB proteins. Although this gene was isolated as a transforming gene from a melanoma cell line, no linkage between MEL and malignant melanoma has been demonstrable. This oncogene is located 800 kb distal to MY09B on chromosome 19p13.1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-49320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1445
Species: Mu, Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-84682
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-33110
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-51634
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
H00005873-M02
Species: Hu, Mu, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RNAi, S-ELISA
NBP2-45500
Species: Hu, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45499
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP1-55113
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
NB120-13253
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP2-25160
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq
Applications: WB, ICC/IF, IHC
NBP1-69095
Species: Hu, Mu, Pm
Applications: WB
NBP1-49533
Species: Hu, Mu, Rt, Pl
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC, KD
NBP1-47492
Species: Hu, Pm
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P
H00005087-M01
Species: Hu, Mu, Pm
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NBP2-14081
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for RAB8A Antibody (H00004218-M02)(8)

We have publications tested in 2 confirmed species: Human, Zebrafish.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(2)
All Applications
Filter By Species
Human
(1)
Zebrafish
(3)
All Species
Showing Publications 1 - 8 of 8.
Publications using H00004218-M02 Applications Species
Nichols E, Smith C, Synaptic-like Vesicles Facilitate Pioneer Axon Invasion Current Biology Aug 1 2019 [PMID: 31378609] (Zebrafish) Zebrafish
Barny I, Perrault I, Michel C et al. Basal exon skipping and nonsense-associated altered splicing allows bypassing complete CEP290 loss-of-function in individuals with unusually mild retinal disease. Hum Mol Genet May 16 2018 [PMID: 29771326]
Goodman L, Zallocchi M Integrin alpha 8 and Pcdh15 act as a complex to regulate cilia biogenesis in sensory cells J Cell Sci. 2017 Oct 31 [PMID: 28883094] (ICC/IF, Zebrafish) ICC/IF Zebrafish
Ojeda Naharros I, Gesemann M, Mateos JM et al. Loss-of-function of the ciliopathy protein Cc2d2a disorganizes the vesicle fusion machinery at the periciliary membrane and indirectly affects Rab8-trafficking in zebrafish photoreceptors PLoS Genet. 2017 Dec 01 [PMID: 29281629] (ICC/IF, Zebrafish) ICC/IF Zebrafish
Stone R, Hayashi T, Bajimaya S et al. Critical role of Rab11a-mediated recycling endosomes in the assembly of type I parainfluenza viruses. Virology. 2015 Oct 17 [PMID: 26484934]
Hampson A, O'Connor A, Smolenski A. Synaptotagmin-like protein 4 and Rab8 interact and increase dense granule release in platelets. J Thromb Haemost. 2013 Jan [PMID: 23140275] (Human) Human
Hsiao Y-C, Tong ZJ, Westfall JE et al. Ahi1, whose human ortholog is mutated in Joubert syndrome, is required for Rab8a localization, ciliogenesis and vesicle trafficking. Hum Mol Genet;18(20):3926-3941. 2009 [PMID: 19625297]

Review for RAB8A Antibody (H00004218-M02) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Other.

Reviews using H00004218-M02:
Filter by Applications
IF
(1)
All Applications
Filter by Species
Other
(1)
All Species
Images Ratings Applications Species Date Details
Immunofluorescence RAB8A H00004218-M02
Enlarge
5
reviewed by:
Anonymous
IF Other 05/12/2016
View

Summary

ApplicationImmunofluorescence
Sample Testedneuromast hair cells
SpeciesOther

Blocking

Blocking DetailsBlocking: PBS containing 0.1%DMSO + 2.5% Tween-20 + 6%FCS + 3%BSA, 1 hour at room temperature

Primary Anitbody

Dilution RatioDilution 1:100 in blocking solution. Incaubation overnight at 4C

Secondary Antibody

Secondary Descriptiondonkey anti-mouse Alexa-Fluor 594
Secondary Manufacturer Cat#Invitrogen
Secondary Concentration1:200 in blocking solution

Details

Detection NotesConfocal micorscopy
Fixation DetailsFixation 4% PFA in PBS containing 4% sucrose and 0.01% Tween-20 overnigth at 4C.
Wash DescriptionWash 3 times 10 minutes each in PBSDTw (PBS + 0.1% DMSO + 0.01% Tween-20)

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RAB8A Antibody (H00004218-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RAB8A Products

Bioinformatics Tool for RAB8A Antibody (H00004218-M02)

Discover related pathways, diseases and genes to RAB8A Antibody (H00004218-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB8A Antibody (H00004218-M02)

Discover more about diseases related to RAB8A Antibody (H00004218-M02).
 

Pathways for RAB8A Antibody (H00004218-M02)

View related products by pathway.

PTMs for RAB8A Antibody (H00004218-M02)

Learn more about PTMs related to RAB8A Antibody (H00004218-M02).

Blogs on RAB8A

There are no specific blogs for RAB8A, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
05/12/2016
Application: IF
Species: Other

Bioinformatics

Gene Symbol RAB8A
Entrez
OMIM
Uniprot