NELL2 Antibody

Images

 
Immunohistochemistry-Paraffin: NELL2 Antibody [NBP1-82527] - Staining of human Fallopian tube shows weak to moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry: NELL2 Antibody [NBP1-82527] - NELL2 expression in the 3% PFA perfused mouse brain Hippocampus and Cortex using primary antibody with 1:100 dilution. This image was submitted via customer Review.
Immunohistochemistry-Paraffin: NELL2 Antibody [NBP1-82527] - Staining of human placenta shows very weak cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: NELL2 Antibody [NBP1-82527] - Staining of human cerebral cortex shows weak to moderate cytoplasmic positivity in neurons.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NELL2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SSGVCVLYECKDQTMKLVESSGCPALDCPESHQITLSHSCCKVCKGYDFCSERHNCMENSICRNLNDRAVCSCRDGFRALR
Specificity
Specificity of human NELL2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NELL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
IHC reported in scientific literature (PMID: 25726761). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NELL2 Protein (NBP1-82527PEP)
Reviewed Applications
Read 1 Review rated 3
using
NBP1-82527 in the following applications:

Publications
Read Publication using
NBP1-82527 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25726761). Reactivity reported in mouse brain Hippocampus and Cortex with 1:100 dilution. From a verified customer review.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NELL2 Antibody

  • Mel91
  • nel (chicken)-like 2
  • NELL2
  • NEL-like 2 (chicken)
  • NEL-like protein 2
  • Nel-related protein 2
  • NRP2
  • NRP2neural epidermal growth factor-like 2
  • protein kinase C-binding protein NELL2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF566
Species: Mu, Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
H00004745-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-81162
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-84682
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF644
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
AF321
Species: Hu
Applications: WB, Flow, IHC, Block, CyTOF-ready
NB100-2218
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF4075
Species: Mu, Rt
Applications: WB, IHC
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF1146
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-82527
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for NELL2 Antibody (NBP1-82527)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Review for NELL2 Antibody (NBP1-82527) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-82527:
Filter by Applications
IHC
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry NELL2 NBP1-82527
Enlarge
3
reviewed by:
Anonymous
IHC Mouse 05/12/2017
View

Summary

ApplicationImmunohistochemistry
Sample TestedAdult mouse brain tissue
SpeciesMouse

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NELL2 Antibody (NBP1-82527) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NELL2 Products

Bioinformatics Tool for NELL2 Antibody (NBP1-82527)

Discover related pathways, diseases and genes to NELL2 Antibody (NBP1-82527). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NELL2 Antibody (NBP1-82527)

Discover more about diseases related to NELL2 Antibody (NBP1-82527).
 

Pathways for NELL2 Antibody (NBP1-82527)

View related products by pathway.

PTMs for NELL2 Antibody (NBP1-82527)

Learn more about PTMs related to NELL2 Antibody (NBP1-82527).

Blogs on NELL2

There are no specific blogs for NELL2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0

Anonymous
05/12/2017
Application: IHC
Species: Mouse

Bioinformatics

Gene Symbol NELL2