NELL2 Antibody

Immunohistochemistry-Paraffin: NELL2 Antibody [NBP1-82527] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.

Immunohistochemistry: NELL2 Antibody [NBP1-82527] - NELL2 expression in the 3% PFA perfused mouse brain Hippocampus and Cortex using primary antibody with 1:100 dilution. Image submitted by a verified customer review.

Immunohistochemistry-Paraffin: NELL2 Antibody [NBP1-82527] - Staining of human placenta shows very weak cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: NELL2 Antibody [NBP1-82527] - Staining of human cerebral cortex shows weak to moderate cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: NELL2 Antibody [NBP1-82527] - Staining of human Fallopian tube shows weak to moderate cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

NELL2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SSGVCVLYECKDQTMKLVESSGCPALDCPESHQITLSHSCCKVCKGYDFCSERHNCMENSICRNLNDRAVCSCRDGFRALR
• Predicted Species: Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NELL2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: Use in Immunocytochemistry/Immunofluorescence reported in scientific literature (PMID:34233189). IHC reported in scientific literature (PMID: 25726761).. For IHC-Paraffin, HIER pH 6 retrieval is recommended. NELL2 antibody validated for IHC from a verified customer review.
• Control Peptide:

  NELL2 Protein (NBP1-82527PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25726761). Mouse brain Hippocampus and Cortex with 1:100 dilution reported from a verified customer review.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NELL2 Antibody

• Mel91
• nel (chicken)-like 2
• NELL2
• NEL-like 2 (chicken)
• NEL-like protein 2
• Nel-related protein 2
• NRP2
• NRP2neural epidermal growth factor-like 2
• protein kinase C-binding protein NELL2

Background

NELL2 is encoded by this gene is a glycoprotein containing several von Willebrand factor C domains and epidermal growth factor (EGF)-like domains. The encoded protein acts as a homotrimer and is found in the cytoplasm. Several variants encoding a few different isoforms exist, and at least one isoform appears to be a secreted protein. Studies in mouse suggest that this protein plays a role in neural cell growth and differentiation as well as in oncogenesis. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NELL2 Antibody (NBP1-82527)(2)

Publications using NBP1-82527

• Jayabal P, Zhou F, Lei X Et Al. NELL2-cdc42 signaling regulates BAF complexes and Ewing sarcoma cell growth Cell reports 2021-07-06 [PMID: 34233189] (ICC/IF)
• Nakamura R, Oyama T, Tajiri R et al. Expression and regulatory effects on cancer cell behavior of NELL1 and NELL2 in human renal cell carcinoma. Cancer Sci 2015-05-01 [PMID: 25726761] (IF/IHC, Human)

Review for NELL2 Antibody (NBP1-82527) (1)

Average Rating: 3

(Based on 1 review)

We have 1 review tested in 1 species: Mouse.

reviewed by: Jin Kwon Jeong IHC Mouse 05/12/2017

Summary

• Application: Immunohistochemistry
• Sample Tested: Adult mouse brain tissue
• Species: Mouse

Bioinformatics

• Gene Symbol: NELL2