Home » NELL1 » NELL1 Antibodies » NELL1 Antibody (6A8)

NELL1 Antibody (6A8)

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: NELL1 Antibody (6A8) [H00004745-M01] - Analysis of NELL1 expression in transfected 293T cell line by NELL1 monoclonal antibody (M01), clone 6A8.Lane 1: NELL1 transfected lysate(89.607 KDa).Lane 2: Non-transfected lysate.
Western Blot: NELL1 Antibody (6A8) [H00004745-M01] - Analysis of NELL1 expression in transfected 293T cell line by NELL1 monoclonal antibody (M01), clone 6A8.Lane 1: NELL1 transfected lysate(89.607 KDa).Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: NELL1 Antibody (6A8) [H00004745-M01] - Analysis of monoclonal antibody to NELL1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunoprecipitation: NELL1 Antibody (6A8) [H00004745-M01] - Analysis of NELL1 transfected lysate using anti-NELL1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with NELL1 MaxPab rabbit polyclonal ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, IP
Clone
6A8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

NELL1 Antibody (6A8) Summary

Immunogen
NELL1 (NP_006148, 304 a.a. ~ 403 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CRRMSCPPLNCSPDSLPVHIAGQCCKVCRPKCIYGGKVLAEGQRILTKSCRECRGGVLVKITEMCPPLNCSEKDHILPENQCCRVCRGHNFCAEGPKCGE
Localization
Secreted
Specificity
NELL1 - NEL-like 1 (chicken)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NELL1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has also been used for IF and ELISA.
Publications
Read Publication using H00004745-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NELL1 Antibody (6A8)

  • FLJ45906
  • IDH3GL
  • nel (chicken)-like 1
  • NELL1
  • NEL-like 1 (chicken)
  • NEL-like protein 1
  • Nel-related protein 1
  • neural epidermal growth factor-like 1
  • NRP1
  • protein kinase C-binding protein NELL1

Background

This gene encodes a cytoplasmic protein that contains epidermal growth factor (EGF) -like repeats. The encoded heterotrimeric protein may be involved in cell growth regulation and differentiation. A similar protein in rodents is involved in craniosynostosis. An alternative splice variant has been described but its full-length sequence has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

VEGF [HRP]
DVE00
(26 Reviews)
(514 Publications)
Species: Hu
Neuropilin-2
Antibody [Unconjugate
AF2215
Western blot shows lysates of HUVEC human umbilical vein endothelial cells. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Neuropilin‑2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2215) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Neuropilin‑2 at approximately 120 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Neuropilin‑2 was detected in immersion fixed paraffin-embedded sections of human pancreatic cancer tissue using Goat Anti-Human/Mouse/Rat Neuropilin‑2 Antigen Affinity-purified Poly­clonal Antibody (Catalog # AF2215) at 5 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Simple Western lane view shows lysates of HUVEC human umbilical vein endothelial cells, C6 rat glioma cell line, LL/2 mouse Lewis lung carcinoma cell line, and bEnd.3 mouse endothelioma cell line, loaded at 0.2 mg/mL. A specific band was detected for Neuropilin‑2 at approximately 140 kDa (as indicated) using 10 µg/mL of Goat Anti-Human/Mouse/Rat Neuropilin‑2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2215) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(2 Reviews)
(14 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, IHC, Block, CyTOF-ready
NELL2 Antibody
NBP1-82527
Immunohistochemistry-Paraffin: NELL2 Antibody [NBP1-82527] - Staining of human Fallopian tube shows weak to moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry: NELL2 Antibody [NBP1-82527] - NELL2 expression in the 3% PFA perfused mouse brain Hippocampus and Cortex using primary antibody with 1:100 dilution. This image was submitted via customer Review.
Immunohistochemistry-Paraffin: NELL2 Antibody [NBP1-82527] - Staining of human placenta shows very weak cytoplasmic positivity in trophoblastic cells.
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P
Semaphorin 3A
[Unconjugated]
1250-S3
RecombinantHuman Semaphorin 3A Fc Chimera binds to Recombinant Rat Neuropilin-1 Fc Chimerain an ELISA Binding Assay. When Recombinant Rat Neuropilin‑1 Fc Chimera (Catalog # 566-N1) is coated at 2µg/ml, Recombinant Human Semaphorin 3A Fc Chimera (Catalog # 1250-S3) binds with anED50= 50-300 ng/mL.
(2 Reviews)
(27 Publications)
Species: Hu
VEGFR2/KDR/Flk-1
Antibody [Unconjugate ...
AF644
Recombinant Mouse VEGFR2/KDR/Flk‑1 Fc Chimera (Catalog # 443-KD) inhibits Recombinant Mouse VEGF164 (Catalog # 493-MV) induced proliferation in HUVEC human umbilical vein endothelial cells in a dose-dependent manner (orange line). Inhibition of Recombinant Mouse VEGF164 (5 ng/mL) activity elicited by Recombinant Mouse VEGFR2/KDR/Flk‑1 Fc Chimera (50 ng/mL) is neutralized (green line) by increasing concentrations of Goat Anti-Mouse VEGFR2/KDR/Flk‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF644). The ND50 is typically 0.1‑0.3 µg/mL.
VEGFR2 was detected in acetone fixed cryosections of mouse kidney tissue using Goat Anti-Mouse VEGFR2/KDR/Flk-1 Polyclonal Antibody (Catalog # AF644) for 50 minutes at room temperature. Tissues were stained with rabbit anti-goat secondaryantibody and HRP polymer-conjugated anti-rabbit IgG followed by AEC+Substrate Chromogen (red) followed by counterstaining with hematoxylin (blue). Experiments were carried out and the image was provided by Dr. Grietje Molema, University Medical Center Groningen, The Netherlands.
VEGFR2/KDR/Flk‑1 was detected in immersion fixed frozen sections of mouse embryo (14 d.p.c.) using 15 µg/mL Goat Anti-Mouse VEGFR2/KDR/Flk‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF644) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific labeling was localized to mesenchymal cells. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(3 Reviews)
(48 Publications)
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NAP1L1 Antibody
NBP1-81162
Western Blot: NAP1L1 Antibody [NBP1-81162] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunohistochemistry-Paraffin: NAP1L1 Antibody [NBP1-81162] - Staining of human tonsil shows strong cytoplasmic positivity in germinal center cells.
Western Blot: NAP1L1 Antibody [NBP1-81162] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Optineurin Antibody
NBP1-84682
Western Blot: Optineurin Antibody [NBP1-84682] - Analysis using Anti-OPTN antibody NBP1-84682 (A) shows similar pattern to independent antibody NBP1-84683 (B).
Immunocytochemistry/Immunofluorescence: Optineurin Antibody [NBP1-84682] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining shown in green.
Immunohistochemistry-Paraffin: Optineurin Antibody [NBP1-84682] - Staining of human pancreas shows no cytoplasmic positivity in exocrine glandular cells as expected.
(2 Reviews)
(1 Publication)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
VEGFR1/Flt-1
Antibody [Unconjugate
AF321
VEGFR1/Flt‑1 was detected in immersion fixed paraffin-embedded sections of human breast cancer tissue using 15 µg/mL Human VEGFR1/Flt‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF321) overnight at 4 °C. Tissue was stained (red) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
VEGFR1/Flt‑1 was detected in immersion fixed paraffin-embedded sections of human ovarian cancer tissue using Human VEGFR1/Flt‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF321) at 3 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(4 Reviews)
(31 Publications)
Species: Hu
Applications: WB, Flow, IHC, Block, CyTOF-ready
Semaphorin 3F
Antibody
NBP1-91480
Western Blot: Semaphorin 3F Antibody [NBP1-91480] - Positive control: Lane1 : No transfection, Lane, 2: Cell lysates from HEK293 cells were transfected with alkaline phosphatase (AP-) tagged Sema3F, Lane3: AP-alone, Lane4: The cell media from cells transfected with AP-Sema3F Primary, Antibody Dilution: 1 ug/ml Secondary Antibody: Anti-AP Secondry, Antibody Dilution: 1 : 1000.
Immunohistochemistry: Semaphorin 3F Antibody [NBP1-91480] - Researcher: Dr. Chrisna LeVaillant, School of Anatomy and Human BiologyApplication: IPSpecies+tissue/cell type: 1. 5mL conditioned media from HEK293F cells transfected with 1 : Sema 3F_AP, 2: Sema3C_FLAG, 3: UntransfectedAmount of IP.
Western Blot: Semaphorin 3F Antibody [NBP1-91480] - Titration: 1.0 ug/ml Positive Control: Mouse Liver.
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
RUNX2/CBFA1
Antibody
NBP1-77461
Immunohistochemistry-Paraffin: RUNX2/CBFA1 Antibody [NBP1-77461] - Vascularization of mineralized cell-laden collagen and interaction with prostate cancer cells. HUVECs formed endothelial networks that were supported by SMA-expressing hMSCs (scale bar: 50m) and were also positive for CD31 (scale bar: 400m). The remainder of hMSCs expressed RUNX2 as a marker for osteogenic differentiation (scale bar: 50m). Rapid fabrication of vascularized and innervated cell-laden bone models with biomimetic intrafibrillar collagen mineralization. Nat Commun (2019)
Immunocytochemistry/Immunofluorescence: RUNX2/CBFA1 Antibody [NBP1-77461] - RUNX2 antibody was tested in HeLa cells with FITC (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
Immunohistochemistry-Paraffin: RUNX2/CBFA1 Antibody [NBP1-77461] - Characterization of TLC cultured in chondrogenic pellets. Gene expression of TLC cultured four weeks in chondrogenic pellets or in cell monolayer in control medium: levels of expression of osteoblast markers (1), chondrocyte markers (2) and tenocyte markers (3) (N = 3) assessed by qPCR.* =0.05. Rotator Cuff Tenocytes Differentiate into Hypertrophic Chondrocyte-Like Cells to Produce Calcium Deposits in an Alkaline Phosphatase-Dependent Manner. J Clin Med (2019)
(9 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Semaphorin 3A
[Unconjugated]
1250-S3
RecombinantHuman Semaphorin 3A Fc Chimera binds to Recombinant Rat Neuropilin-1 Fc Chimerain an ELISA Binding Assay. When Recombinant Rat Neuropilin‑1 Fc Chimera (Catalog # 566-N1) is coated at 2µg/ml, Recombinant Human Semaphorin 3A Fc Chimera (Catalog # 1250-S3) binds with anED50= 50-300 ng/mL.
(2 Reviews)
(27 Publications)
Species: Hu
HGF [Unconjugated]
294-HG
Measured by its ability to induce IL-11 secretion by Saos‑2 human osteosarcoma cells. The ED50 for this effect is 0.1‑0.5 ng/mL.
(4 Reviews)
(83 Publications)
Species: Hu
EGF [Unconjugated]
236-EG
1 µg/lane of Recombinant Human EGF was resolved with SDS-PAGE  and visualized by silver staining under reducing (R) conditions, showing a single band at 6 kDa.
Recombinant Human EGF (Catalog # 236‑EG) stimulates cell proliferation of the Balb/3T3 mouse embryonic fibroblast cell line. The ED50 for this effect is 20‑100 pg/mL.
(21 Reviews)
(457 Publications)
Species: Hu
ERK1 Antibody (1E5)
NBP2-22203
Western Blot: ERK1 Antibody (1E5) [NBP2-22203] - Western blot analysis of whole cell lysates from (1) MCF7 (2) NIH3T3 cell lines using ERK1 antibody (clone 1E5) at 1:1000 dilution. The signal was developed using HRP labeled goat-anti Mouse secondary antibody with ECL based detection.
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Immunohistochemical analysis of paraffin-embedded breast cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
PLGF [HRP]
DPG00
(62 Publications)
Species: Hu
Semaphorin 3B
Antibody
NB100-2218
Western Blot: Semaphorin 3B Antibody [NB100-2218] - Western blot analysis of SEMA3B in A. Hela WCE B. Ntera2 C. A431 D. HepG2 E. MCF7 F. NIH/3T3 G. PC12 H. Cos7
Immunocytochemistry/Immunofluorescence: Semaphorin 3B Antibody [NB100-2218] - SEMA3B antibody (1:50) was tested in HeLa cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red). Image objective 40x.
Immunohistochemistry-Paraffin: Semaphorin 3B Antibody [NB100-2218] - IHC analysis of a formalin fixed paraffin embedded tissue section of mouse kidney using 1:200 dilution of rabbit anti-Semaphorin 3B antibody. This antibody generated a weak to moderate cytoplasmic staining in the cells of various renal tubules and glomeruli.
(2 Publications)
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for NELL1 Antibody (H00004745-M01)(1)


Reviews for NELL1 Antibody (H00004745-M01) (0)

There are no reviews for NELL1 Antibody (H00004745-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NELL1 Antibody (H00004745-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional NELL1 Products

Bioinformatics Tool for NELL1 Antibody (H00004745-M01)

Discover related pathways, diseases and genes to NELL1 Antibody (H00004745-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NELL1 Antibody (H00004745-M01)

Discover more about diseases related to NELL1 Antibody (H00004745-M01).
 

Pathways for NELL1 Antibody (H00004745-M01)

View related products by pathway.

PTMs for NELL1 Antibody (H00004745-M01)

Learn more about PTMs related to NELL1 Antibody (H00004745-M01).

Blogs on NELL1

There are no specific blogs for NELL1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NELL1 Antibody (6A8) and receive a gift card or discount.


Bioinformatics

Gene Symbol NELL1
Entrez
OMIM
Uniprot