OATP1B3/SLCO1B3/OATP8 Antibody


Orthogonal Strategies: Immunohistochemistry-Paraffin: OATP1B3/SLCO1B3/OATP8 Antibody [NBP1-80980] - Staining in human liver and kidney tissues using NBP1-80980 antibody. Corresponding SLCO1B3 RNA-seq data are ...read more
Western Blot: OATP1B3/SLCO1B3/OATP8 Antibody [NBP1-80980] - Analysis in control (vector only transfected HEK293T lysate) and SLCO1B3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in ...read more
Immunocytochemistry/ Immunofluorescence: OATP1B3/SLCO1B3/OATP8 Antibody [NBP1-80980] - Staining of human cell line A-431 shows positivity in cytoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: OATP1B3/SLCO1B3/OATP8 Antibody [NBP1-80980] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: OATP1B3/SLCO1B3/OATP8 Antibody [NBP1-80980] - Staining of human kidney shows no positivity in cells in tubules as expected.
Immunohistochemistry-Paraffin: OATP1B3/SLCO1B3/OATP8 Antibody [NBP1-80980] - Staining of human liver shows strong membranous positivity in hepatocytes.
Immunohistochemistry-Paraffin: OATP1B3/SLCO1B3/OATP8 Antibody [NBP1-80980] - Staining of human skin shows no positivity in squamous epithelial cells as expected.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

OATP1B3/SLCO1B3/OATP8 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: QGKDTKASDNERKVMDEANLEFLNNGEHFVPSAGTDSKTCNLDMQDNAAA
Specificity of human OATP1B3/SLCO1B3/OATP8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04 - 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
OATP1B3/SLCO1B3/OATP8 Protein (NBP1-80980PEP)
Read Publications using
NBP1-80980 in the following applications:

  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25625007).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for OATP1B3/SLCO1B3/OATP8 Antibody

  • Liver-specific organic anion transporter 2
  • liver-specific organic anion transporter 3TM13
  • LST2
  • LST-2
  • LST3
  • OATP1B3
  • OATP1B3LST-3TM13
  • OATP8
  • OATP-8
  • Organic anion transporter 8
  • organic anion transporter LST-3c
  • Organic anion-transporting polypeptide 8
  • SLC21A8
  • SLCO1B3
  • solute carrier family 21 (organic anion transporter), member 8
  • Solute carrier family 21 member 8
  • solute carrier organic anion transporter family member 1B3
  • solute carrier organic anion transporter family, member 1B3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu
Applications: WB, IP, DirELISA
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, CyTOF-ready, Dual ISH-IHC
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA

Publications for OATP1B3/SLCO1B3/OATP8 Antibody (NBP1-80980)(2)

Reviews for OATP1B3/SLCO1B3/OATP8 Antibody (NBP1-80980) (0)

There are no reviews for OATP1B3/SLCO1B3/OATP8 Antibody (NBP1-80980). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for OATP1B3/SLCO1B3/OATP8 Antibody (NBP1-80980) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional OATP1B3/SLCO1B3/OATP8 Products

Bioinformatics Tool for OATP1B3/SLCO1B3/OATP8 Antibody (NBP1-80980)

Discover related pathways, diseases and genes to OATP1B3/SLCO1B3/OATP8 Antibody (NBP1-80980). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OATP1B3/SLCO1B3/OATP8 Antibody (NBP1-80980)

Discover more about diseases related to OATP1B3/SLCO1B3/OATP8 Antibody (NBP1-80980).

Pathways for OATP1B3/SLCO1B3/OATP8 Antibody (NBP1-80980)

View related products by pathway.

PTMs for OATP1B3/SLCO1B3/OATP8 Antibody (NBP1-80980)

Learn more about PTMs related to OATP1B3/SLCO1B3/OATP8 Antibody (NBP1-80980).

Blogs on OATP1B3/SLCO1B3/OATP8.

OATP8 - A membrane transport protein responsible for cancer drug uptake
Human hepatocytes express important transport proteins that are responsible for the uptake and removal of organic anions from the blood. These proteins are members of the organic anion-transporting polypeptide (OATP) family and are essential for pr...  Read full blog post.

Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our OATP1B3/SLCO1B3/OATP8 Antibody and receive a gift card or discount.


Gene Symbol SLCO1B3