Novus Biologicals products are now on bio-techne.com

OATP1B3/SLCO1B3/OATP8 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: OATP1B3/SLCO1B3/OATP8 Antibody [NBP1-80980] - Staining in human liver and kidney tissues using NBP1-80980 antibody. Corresponding SLCO1B3 RNA-seq data are ...read more
Immunocytochemistry/ Immunofluorescence: OATP1B3/SLCO1B3/OATP8 Antibody [NBP1-80980] - Staining of human cell line A-431 shows positivity in cytoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: OATP1B3/SLCO1B3/OATP8 Antibody [NBP1-80980] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: OATP1B3/SLCO1B3/OATP8 Antibody [NBP1-80980] - Staining of human kidney shows no positivity in cells in tubules as expected.
Immunohistochemistry-Paraffin: OATP1B3/SLCO1B3/OATP8 Antibody [NBP1-80980] - Staining of human liver shows strong membranous positivity in hepatocytes.
Immunohistochemistry-Paraffin: OATP1B3/SLCO1B3/OATP8 Antibody [NBP1-80980] - Staining of human skin shows no positivity in squamous epithelial cells as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

OATP1B3/SLCO1B3/OATP8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QGKDTKASDNERKVMDEANLEFLNNGEHFVPSAGTDSKTCNLDMQDNAAA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLCO1B3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
OATP1B3/SLCO1B3/OATP8 Protein (NBP1-80980PEP)
Publications
Read Publications using
NBP1-80980 in the following applications:

  • 1 publication
  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for OATP1B3/SLCO1B3/OATP8 Antibody

  • Liver-specific organic anion transporter 2
  • liver-specific organic anion transporter 3TM13
  • LST2
  • LST-2
  • LST3
  • OATP1B3
  • OATP1B3LST-3TM13
  • OATP8
  • OATP-8
  • Organic anion transporter 8
  • organic anion transporter LST-3c
  • Organic anion-transporting polypeptide 8
  • SLC21A8
  • SLCO1B3
  • solute carrier family 21 (organic anion transporter), member 8
  • Solute carrier family 21 member 8
  • solute carrier organic anion transporter family member 1B3
  • solute carrier organic anion transporter family, member 1B3

Background

The OATPs (organic anion transporter polypeptides) are a family of transport proteins that have been found to mediate the uptake of organic ions into hepatocyte cells. These proteins fall into the solute carrier family 21A (SLC21A), and are expressed in liver, kidney, and brain. These polypeptides are involved in the excretion of potentially toxic compounds and therefore play a role in the overall detoxification system of the body. Unlike other members of the OATP family, OATP2 and 8 have been detected exclusively in the liver, and there is an 80% amino acid sequence homology between these polypeptides. Other names for OATP2 include SLC21A6, OATP-C, and LST-1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74482
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-85770
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-69023
Species: Mu
Applications: WB
NBP1-59811
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-67667
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-22124
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-76670
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP1-51684
Species: Hu, Mu
Applications: EM, ELISA, Flow, ICC/IF, IHC, WB
NBP1-60109
Species: Hu
Applications: B/N, Flow, WB
NBP2-37923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89319
Species: Hu
Applications: IHC, IHC-P
NBP2-37502
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
NB400-156
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, WB
PP-A9033A-00
Species: Hu
Applications: DirELISA, IHC, IP, WB
NBP1-80977
Species: Hu
Applications: IHC, IHC-P
AF4014
Species: Hu
Applications: WB
NB100-1471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB

Publications for OATP1B3/SLCO1B3/OATP8 Antibody (NBP1-80980)(3)

Reviews for OATP1B3/SLCO1B3/OATP8 Antibody (NBP1-80980) (0)

There are no reviews for OATP1B3/SLCO1B3/OATP8 Antibody (NBP1-80980). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for OATP1B3/SLCO1B3/OATP8 Antibody (NBP1-80980) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional OATP1B3/SLCO1B3/OATP8 Products

Research Areas for OATP1B3/SLCO1B3/OATP8 Antibody (NBP1-80980)

Find related products by research area.

Blogs on OATP1B3/SLCO1B3/OATP8.

OATP8 - A membrane transport protein responsible for cancer drug uptake
Human hepatocytes express important transport proteins that are responsible for the uptake and removal of organic anions from the blood. These proteins are members of the organic anion-transporting polypeptide (OATP) family and are essential for pr...  Read full blog post.

mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OATP1B3/SLCO1B3/OATP8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLCO1B3
Entrez
Uniprot