Orthogonal Strategies: Immunohistochemistry-Paraffin: OATP1B3/SLCO1B3/OATP8 Antibody [NBP1-80980] - Staining in human liver and kidney tissues using NBP1-80980 antibody. Corresponding SLCO1B3 RNA-seq data are ...read more
Immunocytochemistry/ Immunofluorescence: OATP1B3/SLCO1B3/OATP8 Antibody [NBP1-80980] - Staining of human cell line A-431 shows positivity in cytoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: OATP1B3/SLCO1B3/OATP8 Antibody [NBP1-80980] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: OATP1B3/SLCO1B3/OATP8 Antibody [NBP1-80980] - Staining of human kidney shows no positivity in cells in tubules as expected.
Immunohistochemistry-Paraffin: OATP1B3/SLCO1B3/OATP8 Antibody [NBP1-80980] - Staining of human liver shows strong membranous positivity in hepatocytes.
Immunohistochemistry-Paraffin: OATP1B3/SLCO1B3/OATP8 Antibody [NBP1-80980] - Staining of human skin shows no positivity in squamous epithelial cells as expected.
Novus Biologicals Rabbit OATP1B3/SLCO1B3/OATP8 Antibody - BSA Free (NBP1-80980) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-OATP1B3/SLCO1B3/OATP8 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QGKDTKASDNERKVMDEANLEFLNNGEHFVPSAGTDSKTCNLDMQDNAAA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLCO1B3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for OATP1B3/SLCO1B3/OATP8 Antibody - BSA Free
Liver-specific organic anion transporter 2
liver-specific organic anion transporter 3TM13
LST2
LST-2
LST3
OATP1B3
OATP1B3LST-3TM13
OATP8
OATP-8
Organic anion transporter 8
organic anion transporter LST-3c
Organic anion-transporting polypeptide 8
SLC21A8
SLCO1B3
solute carrier family 21 (organic anion transporter), member 8
Solute carrier family 21 member 8
solute carrier organic anion transporter family member 1B3
solute carrier organic anion transporter family, member 1B3
Background
The OATPs (organic anion transporter polypeptides) are a family of transport proteins that have been found to mediate the uptake of organic ions into hepatocyte cells. These proteins fall into the solute carrier family 21A (SLC21A), and are expressed in liver, kidney, and brain. These polypeptides are involved in the excretion of potentially toxic compounds and therefore play a role in the overall detoxification system of the body. Unlike other members of the OATP family, OATP2 and 8 have been detected exclusively in the liver, and there is an 80% amino acid sequence homology between these polypeptides. Other names for OATP2 include SLC21A6, OATP-C, and LST-1.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Reviews for OATP1B3/SLCO1B3/OATP8 Antibody (NBP1-80980) (0)
There are no reviews for OATP1B3/SLCO1B3/OATP8 Antibody (NBP1-80980).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our OATP1B3/SLCO1B3/OATP8 Antibody - BSA Free and receive a gift card or discount.