SLC10A1 Antibody

Western Blot: SLC10A1 Antibody [NBP1-60109] - Sample Tissue: Human MDA-MB-435s Antibody Dilution: 1.0 ug/ml

Western Blot: SLC10A1 Antibody [NBP1-60109] - Titration: 0.2-1 ug/ml, Positive Control: HT1080 cell lysate.

Western Blot: SLC10A1 Antibody [NBP1-60109] - Sample Tissue: HT1080, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane/lane, Gel Concentration: 0.12

• Reactivity: Hu
• Applications: WB, Flow, B/N
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

SLC10A1 Antibody Summary

• Immunogen: Synthetic peptides corresponding to SLC10A1(solute carrier family 10 (sodium/bile acid cotransporter family), member 1) The peptide sequence was selected from the middle region of SLC10A1 (NP_003040). Peptide sequence VFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPY The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC10A1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Block/Neutralize
  • Flow Cytometry
  • Western Blot 1.0 ug/ml
• Application Notes: Use in Flow Cytometry, B/N reported in scientific literature (PMID:34266968). This is a rabbit polyclonal antibody against SLC10A1 and was validated on Western blot.
• Theoretical MW: 38 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS & 2% Sucrose.
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC10A1 Antibody

• Cell growth-inhibiting gene 29 protein
• Na(+)/bile acid cotransporter
• Na(+)/taurocholate transport protein
• Na/taurocholate cotransporting polypeptide
• NTCP
• NTCP1
• NTCPgrowth-inhibiting protein 29
• sodium/bile acid cotransporter
• sodium/taurocholate cotransporter
• Sodium/taurocholate cotransporting polypeptide
• solute carrier family 10 (sodium/bile acid cotransporter family), member 1
• Solute carrier family 10 member 1

Background

Sodium/bile acid cotransporters are integral membrane glycoproteins that participate in the enterohepatic circulation of bile acids. Two homologous transporters are involved in the reabsorption of bile acids, one absorbing from the intestinal lumen, the b

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SLC10A1 Antibody (NBP1-60109)(1)

Publication using NBP1-60109

• Salhab A, Amer J, Lu Y, Safadi R Sodium+/taurocholate cotransporting polypeptide as target therapy for liver fibrosis Gut 2021-07-15 [PMID: 34266968] (B/N, FLOW)

Bioinformatics

• Gene Symbol: SLC10A1
• Entrez:
  • 6554(Human)
• Uniprot:
  • Q14973(Human)