SLC10A1 Antibody

Images

 
Western Blot: SLC10A1 Antibody [NBP1-60109] - Sample Tissue: Human MDA-MB-435s Antibody Dilution: 1.0 ug/ml
Western Blot: SLC10A1 Antibody [NBP1-60109] - Titration: 0.2-1 ug/ml, Positive Control: HT1080 cell lysate.
Western Blot: SLC10A1 Antibody [NBP1-60109] - Sample Tissue: HT1080, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Flow, B/N
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

SLC10A1 Antibody Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to SLC10A1(solute carrier family 10 (sodium/bile acid cotransporter family), member 1) The peptide sequence was selected from the middle region of SLC10A1 (NP_003040). Peptide sequence VFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPY The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC10A1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Block/Neutralize
  • Flow Cytometry
  • Western Blot 1.0 ug/ml
Application Notes
Use in Flow Cytometry, B/N reported in scientific literature (PMID:34266968).
Theoretical MW
38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using NBP1-60109.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for SLC10A1 Antibody

  • Cell growth-inhibiting gene 29 protein
  • Na(+)/bile acid cotransporter
  • Na(+)/taurocholate transport protein
  • Na/taurocholate cotransporting polypeptide
  • NTCP
  • NTCP1
  • NTCPgrowth-inhibiting protein 29
  • sodium/bile acid cotransporter
  • sodium/taurocholate cotransporter
  • Sodium/taurocholate cotransporting polypeptide
  • solute carrier family 10 (sodium/bile acid cotransporter family), member 1
  • Solute carrier family 10 member 1

Background

Sodium/bile acid cotransporters are integral membrane glycoproteins that participate in the enterohepatic circulation of bile acids. Two homologous transporters are involved in the reabsorption of bile acids, one absorbing from the intestinal lumen, the b

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SLC10A1 Antibody (NBP1-60109)(1)

We have publications tested in 2 applications: B/N, FLOW.


Filter By Application
B/N
(1)
FLOW
(1)
All Applications
Filter By Species
All Species

Reviews for SLC10A1 Antibody (NBP1-60109) (0)

There are no reviews for SLC10A1 Antibody (NBP1-60109). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC10A1 Antibody (NBP1-60109) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC10A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC10A1
Entrez
Uniprot