SLC10A1 Antibody

Images

 
Western Blot: SLC10A1 Antibody [NBP1-60109] - Sample Tissue: Human MDA-MB-435s Antibody Dilution: 1.0 ug/ml
Western Blot: SLC10A1 Antibody [NBP1-60109] - Titration: 0.2-1 ug/ml, Positive Control: HT1080 cell lysate.
Western Blot: SLC10A1 Antibody [NBP1-60109] - Sample Tissue: HT1080, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate ...read more

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC10A1 Antibody Summary

Immunogen
Synthetic peptides corresponding to SLC10A1(solute carrier family 10 (sodium/bile acid cotransporter family), member 1) The peptide sequence was selected from the middle region of SLC10A1 (NP_003040). Peptide sequence VFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLY The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Canine (100%), Equine (93%), Bovine (93%), Guinea Pig (100%), Rabbit (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC10A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against SLC10A1 and was validated on Western blot.
Theoretical MW
38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC10A1 Antibody

  • Cell growth-inhibiting gene 29 protein
  • Na(+)/bile acid cotransporter
  • Na(+)/taurocholate transport protein
  • Na/taurocholate cotransporting polypeptide
  • NTCP
  • NTCP1
  • NTCPgrowth-inhibiting protein 29
  • sodium/bile acid cotransporter
  • sodium/taurocholate cotransporter
  • Sodium/taurocholate cotransporting polypeptide
  • solute carrier family 10 (sodium/bile acid cotransporter family), member 1
  • Solute carrier family 10 member 1

Background

Sodium/bile acid cotransporters are integral membrane glycoproteins that participate in the enterohepatic circulation of bile acids. Two homologous transporters are involved in the reabsorption of bile acids, one absorbing from the intestinal lumen, the b

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89319
Species: Hu
Applications: IHC, IHC-P
NBP2-66958
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00006690-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, S-ELISA
NBP2-85770
Species: Hu
Applications: WB, IHC, IHC-P
NB100-74482
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-76670
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-37923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30876
Species: Hu
Applications: IHC, IHC-P
NBP1-36987
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, CyTOF-ready, Dual ISH-IHC
NBP1-80977
Species: Hu
Applications: IHC, IHC-P
NBP1-80980
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB400-153
Species: Hu, Mu
Applications: WB, ICC/IF
NB100-80870
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ELISA, IHC, IHC-P
NBP2-61816
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB9120
Species: Hu
Applications: ICC
NBP1-51684
Species: Hu, Mu
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC
NBP1-60109
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb
Applications: WB

Publications for SLC10A1 Antibody (NBP1-60109) (0)

There are no publications for SLC10A1 Antibody (NBP1-60109).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC10A1 Antibody (NBP1-60109) (0)

There are no reviews for SLC10A1 Antibody (NBP1-60109). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC10A1 Antibody (NBP1-60109) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SLC10A1 Products

Bioinformatics Tool for SLC10A1 Antibody (NBP1-60109)

Discover related pathways, diseases and genes to SLC10A1 Antibody (NBP1-60109). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC10A1 Antibody (NBP1-60109)

Discover more about diseases related to SLC10A1 Antibody (NBP1-60109).
 

Pathways for SLC10A1 Antibody (NBP1-60109)

View related products by pathway.

PTMs for SLC10A1 Antibody (NBP1-60109)

Learn more about PTMs related to SLC10A1 Antibody (NBP1-60109).

Blogs on SLC10A1

There are no specific blogs for SLC10A1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC10A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC10A1
Entrez
Uniprot