SLCO2B1 Antibody

Western Blot: SLCO2B1 Antibody [NBP1-59811] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.

Immunocytochemistry/Immunofluorescence: SLCO2B1 Antibody [NBP1-59811] - Formalin Fixed Paraffin; Embedded Tissue: Human Lung Tissue; Observed Staining: Membrane in alveolar type I cells; Primary Antibody Concentration: 1:100

Western Blot: SLCO2B1 Antibody [NBP1-59811] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.

Western Blot: SLCO2B1 Antibody [NBP1-59811] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

SLCO2B1 Antibody Summary

• Immunogen: Synthetic peptides corresponding to SLCO2B1(solute carrier organic anion transporter family, member 2B1) The peptide sequence was selected from the N terminal of SLCO2B1. Peptide sequence DPQDVRPSVFHNIKLFVLCHSLLQLAQLMISGYLKSSISTVEKRFGLSSQ. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLCO2B1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against SLCO2B1 and was validated on Western blot.
• Theoretical MW: 77 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLCO2B1 Antibody

• OATP2B1OATP-RP2
• OATPBDKFZp686E0517
• OATP-BKIAA0880
• OATPRP2
• Organic anion transporter B
• Organic anion transporter polypeptide-related protein 2
• SLC21A9solute carrier organic anion transporter family member 2B1
• solute carrier family 21 (organic anion transporter), member 9
• Solute carrier family 21 member 9
• solute carrier organic anion transporter family, member 2B1

Background

SLCO2B1 mediates the Na+-independent transport of organic anions such as taurocholate, the prostaglandins PGD2, PGE1, PGE2, leukotriene C4, thromboxane B2 and iloprost.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLCO2B1
• Entrez:
  • 11309(Human)
• Uniprot:
  • O94956(Human)