Novus Biologicals products are now on bio-techne.com

SLCO2B1 Antibody

Images

 
Western Blot: SLCO2B1 Antibody [NBP1-59811] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Immunohistochemistry-Paraffin: SLCO2B1 Antibody [NBP1-59811] - Formalin Fixed Paraffin; Embedded Tissue: Human Lung Tissue; Observed Staining: Membrane in alveolar type I cells; Primary Antibody Concentration: 1:100
Western Blot: SLCO2B1 Antibody [NBP1-59811] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.
Western Blot: SLCO2B1 Antibody [NBP1-59811] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

SLCO2B1 Antibody Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to SLCO2B1(solute carrier organic anion transporter family, member 2B1) The peptide sequence was selected from the N terminal of SLCO2B1. Peptide sequence DPQDVRPSVFHNIKLFVLCHSLLQLAQLMISGYLKSSISTVEKRFGLSSQ. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLCO2B1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
Theoretical MW
77 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for SLCO2B1 Antibody

  • OATP2B1OATP-RP2
  • OATPBDKFZp686E0517
  • OATP-BKIAA0880
  • OATPRP2
  • Organic anion transporter B
  • Organic anion transporter polypeptide-related protein 2
  • SLC21A9solute carrier organic anion transporter family member 2B1
  • solute carrier family 21 (organic anion transporter), member 9
  • Solute carrier family 21 member 9
  • solute carrier organic anion transporter family, member 2B1

Background

SLCO2B1 mediates the Na+-independent transport of organic anions such as taurocholate, the prostaglandins PGD2, PGE1, PGE2, leukotriene C4, thromboxane B2 and iloprost.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-85770
Species: Hu
Applications: IHC, IHC-P, WB
NB100-74482
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-80980
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-22124
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-69023
Species: Mu
Applications: WB
NBP2-67667
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB400-156
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, WB
NBP1-80977
Species: Hu
Applications: IHC, IHC-P
NB100-1471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
NBP2-37923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-59678
Species: Hu
Applications: WB
NBP1-76670
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP1-51684
Species: Hu, Mu
Applications: EM, ELISA, Flow, ICC/IF, IHC, WB
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-59656
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-13349
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89319
Species: Hu
Applications: IHC, IHC-P
NBP1-92005
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-59811
Species: Hu
Applications: WB, IHC

Publications for SLCO2B1 Antibody (NBP1-59811) (0)

There are no publications for SLCO2B1 Antibody (NBP1-59811).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLCO2B1 Antibody (NBP1-59811) (0)

There are no reviews for SLCO2B1 Antibody (NBP1-59811). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLCO2B1 Antibody (NBP1-59811) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLCO2B1 Products

Research Areas for SLCO2B1 Antibody (NBP1-59811)

Find related products by research area.

Blogs on SLCO2B1

There are no specific blogs for SLCO2B1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLCO2B1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLCO2B1
Entrez
Uniprot