SLCO2B1 Antibody


Western Blot: SLCO2B1 Antibody [NBP1-59811] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Immunocytochemistry/ Immunofluorescence: SLCO2B1 Antibody [NBP1-59811] - Formalin Fixed Paraffin; Embedded Tissue: Human Lung Tissue; Observed Staining: Membrane in alveolar type I cells; Primary Antibody Concentration: more
Western Blot: SLCO2B1 Antibody [NBP1-59811] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.
Western Blot: SLCO2B1 Antibody [NBP1-59811] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC

Order Details

SLCO2B1 Antibody Summary

Synthetic peptides corresponding to SLCO2B1(solute carrier organic anion transporter family, member 2B1) The peptide sequence was selected from the N terminal of SLCO2B1. Peptide sequence DPQDVRPSVFHNIKLFVLCHSLLQLAQLMISGYLKSSISTVEKRFGLSSQ.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against SLCO2B1 and was validated on Western blot.
Theoretical MW
77 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLCO2B1 Antibody

  • OATPBDKFZp686E0517
  • OATP-BKIAA0880
  • Organic anion transporter B
  • Organic anion transporter polypeptide-related protein 2
  • SLC21A9solute carrier organic anion transporter family member 2B1
  • solute carrier family 21 (organic anion transporter), member 9
  • Solute carrier family 21 member 9
  • solute carrier organic anion transporter family, member 2B1


SLCO2B1 mediates the Na+-independent transport of organic anions such as taurocholate, the prostaglandins PGD2, PGE1, PGE2, leukotriene C4, thromboxane B2 and iloprost.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: Flow, IHC, IHC-P
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC

Publications for SLCO2B1 Antibody (NBP1-59811) (0)

There are no publications for SLCO2B1 Antibody (NBP1-59811).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLCO2B1 Antibody (NBP1-59811) (0)

There are no reviews for SLCO2B1 Antibody (NBP1-59811). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SLCO2B1 Antibody (NBP1-59811) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SLCO2B1 Products

Bioinformatics Tool for SLCO2B1 Antibody (NBP1-59811)

Discover related pathways, diseases and genes to SLCO2B1 Antibody (NBP1-59811). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLCO2B1 Antibody (NBP1-59811)

Discover more about diseases related to SLCO2B1 Antibody (NBP1-59811).

Pathways for SLCO2B1 Antibody (NBP1-59811)

View related products by pathway.

PTMs for SLCO2B1 Antibody (NBP1-59811)

Learn more about PTMs related to SLCO2B1 Antibody (NBP1-59811).

Blogs on SLCO2B1

There are no specific blogs for SLCO2B1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SLCO2B1 Antibody and receive a gift card or discount.


Gene Symbol SLCO2B1