MRP3 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: MRP3 Antibody [NBP2-37923] - Staining in human stomach and skeletal muscle tissues.. Corresponding ABCC3 RNA-seq data are presented for the same tissues.
Immunocytochemistry/ Immunofluorescence: MRP3 Antibody [NBP2-37923] - Immunofluorescent staining of human cell line A549 shows localization to plasma membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MRP3 Antibody [NBP2-37923] - Staining of human stomach shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: MRP3 Antibody [NBP2-37923] - Staining of human duodenum shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: MRP3 Antibody [NBP2-37923] - Staining of human skeletal muscle shows no positivity in myocytes.
Immunohistochemistry-Paraffin: MRP3 Antibody [NBP2-37923] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

MRP3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: FLPQTDFIIVLADGQVSEMGPYPALLQRNGSFANFLCNYAPDEDQGHLEDSWTALEGAEDKEALLIEDTLSNHTDLTDNDPVTYVVQKQFMRQLSALSSDGEGQGRPVPRRHLGPSEKVQVTEAKADGALT
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ABCC3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MRP3 Protein (NBP2-37923PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MRP3 Antibody

  • ABC31
  • ABCC3
  • ATP-binding cassette sub-family C member 3
  • ATP-binding cassette, sub-family C (CFTR/MRP), member 3
  • canalicular multispecific organic anion transporter 2
  • canicular multispecific organic anion transporter
  • CMOAT2
  • EC 3.6.3
  • EC 3.6.3.44
  • EC 6.3.2.4
  • EC 7.6.2.3
  • MLP2
  • MLP2DKFZp686E22157
  • MOAT-D
  • MRP3
  • MRP3MOAT-DEST90757
  • multidrug resistance associated protein
  • Multidrug resistance-associated protein 3
  • Multi-specific organic anion transporter D

Background

The protein encoded by the MRP3 gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. The specific function of this protein has not yet been determined; however, this protein may play a role in the transport of biliary and intestinal excretion of organic anions. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MRP3 Antibody (NBP2-37923) (0)

There are no publications for MRP3 Antibody (NBP2-37923).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRP3 Antibody (NBP2-37923) (0)

There are no reviews for MRP3 Antibody (NBP2-37923). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MRP3 Antibody (NBP2-37923) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MRP3 Products

Research Areas for MRP3 Antibody (NBP2-37923)

Find related products by research area.

Blogs on MRP3

There are no specific blogs for MRP3, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MRP3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCC3
Uniprot