MRP3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MRP3 Antibody [NBP2-37923] - Immunofluorescent staining of human cell line A549 shows localization to plasma membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MRP3 Antibody [NBP2-37923] - Staining of human stomach shows strong membranous positivity in glandular cells.
Orthogonal Strategies: Immunohistochemistry-Paraffin: MRP3 Antibody [NBP2-37923] - Staining in human stomach and skeletal muscle tissues.. Corresponding ABCC3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: MRP3 Antibody [NBP2-37923] - Staining of human duodenum shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: MRP3 Antibody [NBP2-37923] - Staining of human skeletal muscle shows no positivity in myocytes.
Immunohistochemistry-Paraffin: MRP3 Antibody [NBP2-37923] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

MRP3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: FLPQTDFIIVLADGQVSEMGPYPALLQRNGSFANFLCNYAPDEDQGHLEDSWTALEGAEDKEALLIEDTLSNHTDLTDNDPVTYVVQKQFMRQLSALSSDGEGQGRPVPRRHLGPSEKVQVTEAKADGALT
Specificity
Specificity of human MRP3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ABCC3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MRP3 Protein (NBP2-37923PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MRP3 Antibody

  • ABC31
  • ATP-binding cassette sub-family C member 3
  • ATP-binding cassette, sub-family C (CFTR/MRP), member 3
  • canalicular multispecific organic anion transporter 2
  • canicular multispecific organic anion transporter
  • cMOAT2
  • EC 3.6.3
  • EC 3.6.3.44
  • EC 6.3.2.4
  • MLP2DKFZp686E22157
  • MRP3MOAT-DEST90757
  • multidrug resistance associated protein
  • Multidrug resistance-associated protein 3
  • Multi-specific organic anion transporter D

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, CyTOF-ready, Dual ISH-IHC
NBP2-66958
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-76670
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
H00065108-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP2-57299
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-19417
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-80870
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ELISA, IHC, IHC-P
NB100-556
Species: Hu
Applications: WB, IP
NB100-1471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-46467
Species: Hu
Applications: WB, IHC
NBP1-89319
Species: Hu
Applications: IHC, IHC-P
NBP2-30876
Species: Hu
Applications: IHC, IHC-P
NBP2-58327
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-42342
Species: Hu
Applications: WB, Flow, IHC, IHC-Fr
NB100-74482
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-61816
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready

Publications for MRP3 Antibody (NBP2-37923) (0)

There are no publications for MRP3 Antibody (NBP2-37923).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRP3 Antibody (NBP2-37923) (0)

There are no reviews for MRP3 Antibody (NBP2-37923). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MRP3 Antibody (NBP2-37923) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MRP3 Products

Bioinformatics Tool for MRP3 Antibody (NBP2-37923)

Discover related pathways, diseases and genes to MRP3 Antibody (NBP2-37923). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRP3 Antibody (NBP2-37923)

Discover more about diseases related to MRP3 Antibody (NBP2-37923).
 

Pathways for MRP3 Antibody (NBP2-37923)

View related products by pathway.

PTMs for MRP3 Antibody (NBP2-37923)

Learn more about PTMs related to MRP3 Antibody (NBP2-37923).

Blogs on MRP3

There are no specific blogs for MRP3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MRP3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCC3
Uniprot