SLCO1A2 Antibody

Images

 
Western Blot: SLCO1A2 Antibody [NBP2-85770] - WB Suggested Anti-SLCO1A2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: PANC1 cell lysateSLCO1A2 is strongly supported by BioGPS gene expression ...read more
Immunohistochemistry-Paraffin: SLCO1A2 Antibody [NBP2-85770] - Rabbit Anti-SLCO1A2 Antibody. Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver. Observed Staining: Membrane, Cytoplasm in hepatocytes, very ...read more
Western Blot: SLCO1A2 Antibody [NBP2-85770] - Host: Rabbit. Target Name: SLCO1A2. Sample Tissue: Human PANC1 Whole Cell. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLCO1A2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SLCO1A2. Peptide sequence: VCGNNGLSYLSACLAGCETSIGTGINMVFQNCSCIQTSGNSSAVLGLCDK The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
SLCO1A2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLCO1A2 Antibody

  • OATP1
  • OATP1A2member 3
  • OATP-AOATP-1
  • OATPSolute carrier family 21 member 3
  • Organic anion-transporting polypeptide 1
  • Sodium-independent organic anion transporter
  • solute carrier organic anion transporter family member 1A2
  • solute carrier organic anion transporter family, member 1A2

Background

The SLCO1A2 gene encodes a sodium-independent transporter which mediates cellular uptake of organic ions in the liver. Its substrates include bile acids, bromosulphophthalein, and some steroidal compounds. The protein is a member of the SLC21A family of solute c

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74482
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-80980
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-59811
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-42349
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-67667
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB400-156
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, WB
NBP1-60109
Species: Hu
Applications: B/N, Flow, WB
NBP1-76670
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP1-89319
Species: Hu
Applications: IHC, IHC-P
NBP2-22124
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-37923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57299
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-51684
Species: Hu, Mu
Applications: EM, ELISA, Flow, ICC/IF, IHC, WB
PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
NBP2-37502
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80977
Species: Hu
Applications: IHC, IHC-P

Publications for SLCO1A2 Antibody (NBP2-85770) (0)

There are no publications for SLCO1A2 Antibody (NBP2-85770).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLCO1A2 Antibody (NBP2-85770) (0)

There are no reviews for SLCO1A2 Antibody (NBP2-85770). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLCO1A2 Antibody (NBP2-85770) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLCO1A2 Products

Bioinformatics Tool for SLCO1A2 Antibody (NBP2-85770)

Discover related pathways, diseases and genes to SLCO1A2 Antibody (NBP2-85770). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLCO1A2 Antibody (NBP2-85770)

Discover more about diseases related to SLCO1A2 Antibody (NBP2-85770).
 

Pathways for SLCO1A2 Antibody (NBP2-85770)

View related products by pathway.

PTMs for SLCO1A2 Antibody (NBP2-85770)

Learn more about PTMs related to SLCO1A2 Antibody (NBP2-85770).
 

Research Areas for SLCO1A2 Antibody (NBP2-85770)

Find related products by research area.

Blogs on SLCO1A2

There are no specific blogs for SLCO1A2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLCO1A2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLCO1A2