Immunocytochemistry/ Immunofluorescence: NT5C Antibody [NBP1-84563] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NT5C Antibody [NBP1-84563] - Staining of human duodenum shows cytoplasmic positivity in glandular cells.
Simple Western: NT5C Antibody [NBP1-84563] - Simple Western lane view shows a specific band for NT5C in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation ...read more
Simple Western: NT5C Antibody [NBP1-84563] - Simple Western lane view shows a specific band for NT5C in 0.2 mg/ml of U-2OS lysate. This experiment was performed under reducing conditions using the 12-230 kDa ...read more
Simple Western: NT5C Antibody [NBP1-84563] - Electropherogram image(s) of corresponding Simple Western lane view. NT5C antibody was used at 1:20 dilution on U-2OS lysates(s).
Genetic Strategies: Knockdown Validated: NT5C Antibody [NBP1-84563] - NT5C regulates cell motility and cell spreading. NT5C regulates single cell spreading. HT1080 cells stably expressing siRNA were trypsinized, ...read more
This antibody was developed against Recombinant Protein corresponding to amino acids: VLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGFFLDLEPIP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NT5C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%)
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for NT5C Antibody
3'-pyrimidine nucleotidase
5' nucleotidase, deoxy (pyrimidine), cytosolic type C
5', 3'-nucleotidase, cytosolic
cdN
Cytosolic 5'
Deoxy-5'-nucleotidase 1
dNT-15'(3')-deoxyribonucleotidase, cytosolic type
DNT1DNT-1
EC 3.1.3.-
P5N2
PN-I
PN-II
UMPH2DNT
uridine 5'-monophosphate phosphohydrolase 2
uridine 5-prime monophosphate hydrolase 2
Background
Pyrimidine 5-prime nucleotidase (P5N; EC 3.1.3.5), also called uridine 5-prime monophosphate hydrolase (UMPH), catalyzes the dephosphorylation of the pyrimidine 5-prime monophosphates UMP and CMP to the corresponding nucleosides. There are 2 isozymes of pyrimidine 5-prime nucleotidase in red blood cells, referred to as type I (UMPH1; MIM 606224) and type II (UMPH2).[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Bioinformatics Tool for NT5C Antibody (NBP1-84563)
Discover related pathways, diseases and genes to NT5C Antibody (NBP1-84563). Need help?
Read the Bioinformatics Tool Guide for instructions on using this tool.
Diseases for NT5C Antibody (NBP1-84563)
Discover more about diseases related to NT5C Antibody (NBP1-84563).
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our NT5C Antibody and receive a gift card or discount.