NT5C Antibody


Immunocytochemistry/ Immunofluorescence: NT5C Antibody [NBP1-84563] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NT5C Antibody [NBP1-84563] - Staining of human duodenum shows cytoplasmic positivity in glandular cells.
Simple Western: NT5C Antibody [NBP1-84563] - Simple Western lane view shows a specific band for NT5C in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation ...read more
Simple Western: NT5C Antibody [NBP1-84563] - Simple Western lane view shows a specific band for NT5C in 0.2 mg/ml of U-2OS lysate. This experiment was performed under reducing conditions using the 12-230 kDa ...read more
Simple Western: NT5C Antibody [NBP1-84563] - Electropherogram image(s) of corresponding Simple Western lane view. NT5C antibody was used at 1:20 dilution on U-2OS lysates(s).
Genetic Strategies: Knockdown Validated: NT5C Antibody [NBP1-84563] - NT5C regulates cell motility and cell spreading. NT5C regulates single cell spreading. HT1080 cells stably expressing siRNA were trypsinized, ...read more

Product Details

Reactivity HuSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P, KD
Validated by:

Genetic Strategies


Order Details

NT5C Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: VLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGFFLDLEPIP
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Simple Western 1:20
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
WB reported in the literature (PMID:28059163). ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
NT5C Protein (NBP1-84563PEP)
Read Publication using
NBP1-84563 in the following applications:

  • WB
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for NT5C Antibody

  • 3'-pyrimidine nucleotidase
  • 5' nucleotidase, deoxy (pyrimidine), cytosolic type C
  • 5', 3'-nucleotidase, cytosolic
  • cdN
  • Cytosolic 5'
  • Deoxy-5'-nucleotidase 1
  • dNT-15'(3')-deoxyribonucleotidase, cytosolic type
  • DNT1DNT-1
  • EC 3.1.3.-
  • P5N2
  • PN-I
  • PN-II
  • uridine 5'-monophosphate phosphohydrolase 2
  • uridine 5-prime monophosphate hydrolase 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ELISA, IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Ca, Gp, Hu, Pm, Rt
Applications: ELISA, ICC/IF, KD, WB
Species: Ca, Ha, Hu, Mu, Po, Pm, Rt
Applications: B/N, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD

Publications for NT5C Antibody (NBP1-84563)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for NT5C Antibody (NBP1-84563) (0)

There are no reviews for NT5C Antibody (NBP1-84563). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NT5C Antibody (NBP1-84563) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional NT5C Products

Bioinformatics Tool for NT5C Antibody (NBP1-84563)

Discover related pathways, diseases and genes to NT5C Antibody (NBP1-84563). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NT5C Antibody (NBP1-84563)

Discover more about diseases related to NT5C Antibody (NBP1-84563).

Pathways for NT5C Antibody (NBP1-84563)

View related products by pathway.

PTMs for NT5C Antibody (NBP1-84563)

Learn more about PTMs related to NT5C Antibody (NBP1-84563).

Blogs on NT5C

There are no specific blogs for NT5C, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NT5C Antibody and receive a gift card or discount.


Gene Symbol NT5C