Immunocytochemistry/ Immunofluorescence: NT5C Antibody [NBP1-84563] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
Simple Western: NT5C Antibody [NBP1-84563] - Simple Western lane view shows a specific band for NT5C in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation ...read more
Simple Western: NT5C Antibody [NBP1-84563] - Electropherogram image(s) of corresponding Simple Western lane view. NT5C antibody was used at 1:20 dilution on U-2OS lysates(s).
Western Blot: NT5C Antibody [NBP1-84563] - Regulation of NT5C S184 phosphorylation.(a) Sensitivity of S184 phosphorylation to PI3K pathway inhibitors. Primary MEFs were treated with A66 (3 μM), MK-2206 (1 μM), ...read more
Western Blot: NT5C Antibody [NBP1-84563] - Impact of S184 phosphorylation of NT5C catalytic activity.(a) S184 phosphorylation does not regulate NT5C nucleotidase activity in vitro. (left) Immunoprecipitates of Flag-NT5C ...read more
Western Blot: NT5C Antibody [NBP1-84563] - Regulation of NT5C S184 phosphorylation.(a) Sensitivity of S184 phosphorylation to PI3K pathway inhibitors. Primary MEFs were treated with A66 (3 μM), MK-2206 (1 μM), ...read more
Western Blot: NT5C Antibody [NBP1-84563] - Impact of S184 phosphorylation of NT5C catalytic activity.(a) S184 phosphorylation does not regulate NT5C nucleotidase activity in vitro. (left) Immunoprecipitates of Flag-NT5C ...read more
Western Blot: NT5C Antibody [NBP1-84563] - Regulation of NT5C S184 phosphorylation.(a) Sensitivity of S184 phosphorylation to PI3K pathway inhibitors. Primary MEFs were treated with A66 (3 μM), MK-2206 (1 μM), ...read more
Immunohistochemistry-Paraffin: NT5C Antibody [NBP1-84563] -Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: NT5C Antibody [NBP1-84563] -Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: NT5C Antibody [NBP1-84563] -Staining of human liver shows weak cytoplasmic positivity in hepatocytes as expected.
Staining of human intestine shows strong cytoplasmic positivity in glandular cells.
This antibody was developed against Recombinant Protein corresponding to amino acids: VLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGFFLDLEPIP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NT5C
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Western Blot Reported in the literature (PMID:28059163).
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-Paraffin HIER pH6 retrieval is recommended. See Simple Western Antibody Database for Simple Western validation: Tested in U-2OS, RT-4, separated by Size, antibody dilution of 1:20, apparent MW was 29 kDa
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%)
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for NT5C Antibody - BSA Free
3'-pyrimidine nucleotidase
5' nucleotidase, deoxy (pyrimidine), cytosolic type C
5', 3'-nucleotidase, cytosolic
cdN
Cytosolic 5'
Deoxy-5'-nucleotidase 1
dNT-15'(3')-deoxyribonucleotidase, cytosolic type
DNT1DNT-1
EC 3.1.3.-
P5N2
PN-I
PN-II
UMPH2DNT
uridine 5'-monophosphate phosphohydrolase 2
uridine 5-prime monophosphate hydrolase 2
Background
Pyrimidine 5-prime nucleotidase (P5N; EC 3.1.3.5), also called uridine 5-prime monophosphate hydrolase (UMPH), catalyzes the dephosphorylation of the pyrimidine 5-prime monophosphates UMP and CMP to the corresponding nucleosides. There are 2 isozymes of pyrimidine 5-prime nucleotidase in red blood cells, referred to as type I (UMPH1; MIM 606224) and type II (UMPH2).[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our NT5C Antibody - BSA Free and receive a gift card or discount.