NT5C Antibody

Immunocytochemistry/Immunofluorescence: NT5C Antibody [NBP1-84563] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: NT5C Antibody [NBP1-84563] - Staining of human duodenum shows cytoplasmic positivity in glandular cells.

Simple Western: NT5C Antibody [NBP1-84563] - Simple Western lane view shows a specific band for NT5C in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: NT5C Antibody [NBP1-84563] - Simple Western lane view shows a specific band for NT5C in 0.2 mg/ml of U-2OS lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: NT5C Antibody [NBP1-84563] - Electropherogram image(s) of corresponding Simple Western lane view. NT5C antibody was used at 1:20 dilution on U-2OS lysates(s).

Knockdown Validated: NT5C Antibody [NBP1-84563] - NT5C regulates cell motility and cell spreading. NT5C regulates single cell spreading. HT1080 cells stably expressing siRNA were trypsinized, seeded onto fibronectin coated plates and fixed at 45 min post-seeding. (left) Cell area was determined manually in ImageJ and is expressed relative to siControl cells. The experiment was repeated 3 times independently. n = 326-431 cells per cell line; Error bars are sem; *p < 0.05, **p < 0.01. (top right) Representative image. (bottom right) Representative immunoblot from experimental cells. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/srep39985), licensed under a CC-BY license.

• Reactivity: Hu
• Applications: WB, Simple Western, ICC/IF, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

NT5C Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGFFLDLEPIP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NT5C
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Simple Western 1:20
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: WB reported in the literature (PMID:28059163). ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-Paraffin HIER pH6 retrieval is recommended.
• Control Peptide:

  NT5C Protein (NBP1-84563PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NT5C Antibody

• 3'-pyrimidine nucleotidase
• 5' nucleotidase, deoxy (pyrimidine), cytosolic type C
• 5', 3'-nucleotidase, cytosolic
• cdN
• Cytosolic 5'
• Deoxy-5'-nucleotidase 1
• dNT-15'(3')-deoxyribonucleotidase, cytosolic type
• DNT1DNT-1
• EC 3.1.3.-
• P5N2
• PN-I
• PN-II
• UMPH2DNT
• uridine 5'-monophosphate phosphohydrolase 2
• uridine 5-prime monophosphate hydrolase 2

Background

Pyrimidine 5-prime nucleotidase (P5N; EC 3.1.3.5), also called uridine 5-prime monophosphate hydrolase (UMPH), catalyzes the dephosphorylation of the pyrimidine 5-prime monophosphates UMP and CMP to the corresponding nucleosides. There are 2 isozymes of pyrimidine 5-prime nucleotidase in red blood cells, referred to as type I (UMPH1; MIM 606224) and type II (UMPH2).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NT5C Antibody (NBP1-84563)(1)

Publication using NBP1-84563

• Moniz LS, Surinova S, Ghazaly E et al. Phosphoproteomic comparison of Pik3ca and Pten signalling identifies the nucleotidase NT5C as a novel AKT substrate Sci Rep 2017-01-06 [PMID: 28059163] (WB, Human)

Bioinformatics

• Gene Symbol: NT5C