Citidine Deaminase Antibody

Western Blot: Citidine Deaminase Antibody [NBP2-39019] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue

Immunocytochemistry/Immunofluorescence: Citidine Deaminase Antibody [NBP2-39019] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Citidine Deaminase Antibody [NBP2-39019] - Staining of human cerebral cortex shows low expression as expected.

Immunohistochemistry: Citidine Deaminase Antibody [NBP2-39019] - Staining of human bone marrow shows moderate cytoplasmic and nuclear positivity in hematopoietic cells.

Immunohistochemistry-Paraffin: Citidine Deaminase Antibody [NBP2-39019] - Staining in human bone marrow and cerebral cortex tissues using anti-CDA antibody. Corresponding CDA RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Citidine Deaminase Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GICAERTAIQKAVSEGYKDFRAIAIASDMQDDFISPCGACRQVMREFGTNWPVYMTKPDGTYIVMTVQE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CDA
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Citidine Deaminase Protein (NBP2-39019PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Citidine Deaminase Antibody

• CDA
• CDD
• CDDCytidine aminohydrolase
• Citidine Deaminase
• cytidine deaminase
• cytosine nucleoside deaminase
• EC 3.5.4.5
• small cytidine deaminase

Background

CDA encodes an enzyme involved in pyrimidine salvaging. The encoded protein forms a homotetramer that catalyzes the irreversible hydrolytic deamination of cytidine and deoxycytidine to uridine and deoxyuridine, respectively. It is one of several deaminases responsible for maintaining the cellular pyrimidine pool. Mutations in this gene are associated with decreased sensitivity to the cytosine nucleoside analogue cytosine arabinoside used in the treatment of certain childhood leukemias. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CDA
• Uniprot:
  • P32320(Human)