Novus Biologicals products are now on bio-techne.com

Citidine Deaminase Antibody

Images

 
Western Blot: Citidine Deaminase Antibody [NBP2-39019] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human ...read more
Immunocytochemistry/ Immunofluorescence: Citidine Deaminase Antibody [NBP2-39019] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Citidine Deaminase Antibody [NBP2-39019] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry: Citidine Deaminase Antibody [NBP2-39019] - Staining of human bone marrow shows moderate cytoplasmic and nuclear positivity in hematopoietic cells.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Citidine Deaminase Antibody [NBP2-39019] - Staining in human bone marrow and cerebral cortex tissues using anti-CDA antibody. Corresponding CDA RNA-seq data ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Citidine Deaminase Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GICAERTAIQKAVSEGYKDFRAIAIASDMQDDFISPCGACRQVMREFGTNWPVYMTKPDGTYIVMTVQE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Citidine Deaminase Protein (NBP2-39019PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Citidine Deaminase Antibody

  • CDA
  • CDD
  • CDDCytidine aminohydrolase
  • Citidine Deaminase
  • cytidine deaminase
  • cytosine nucleoside deaminase
  • EC 3.5.4.5
  • small cytidine deaminase

Background

CDA encodes an enzyme involved in pyrimidine salvaging. The encoded protein forms a homotetramer that catalyzes the irreversible hydrolytic deamination of cytidine and deoxycytidine to uridine and deoxyuridine, respectively. It is one of several deaminases responsible for maintaining the cellular pyrimidine pool. Mutations in this gene are associated with decreased sensitivity to the cytosine nucleoside analogue cytosine arabinoside used in the treatment of certain childhood leukemias. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30955
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88592
Species: Hu
Applications: IHC, IHC-P
NBP1-06977
Species: Mu
Applications: PEP-ELISA, WB
NBP2-43639
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-92770
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-87404
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
6507-IL/CF
Species: Hu
Applications: BA
MAB4124
Species: Hu
Applications: IHC, Simple Western, WB
NB600-1031
Species: Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-84838
Species: Hu
Applications: ICC/IF, IHC, IHC-P
DCDL40
Species: Hu
Applications: ELISA
NBP2-13286
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00001635-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, KD, S-ELISA, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP1-90271
Species: Hu
Applications: IHC, IHC-P, WB
NB100-2737
Species: Hu
Applications: ICC/IF, IHC, IP, WB
NBP3-25721
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for Citidine Deaminase Antibody (NBP2-39019) (0)

There are no publications for Citidine Deaminase Antibody (NBP2-39019).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Citidine Deaminase Antibody (NBP2-39019) (0)

There are no reviews for Citidine Deaminase Antibody (NBP2-39019). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Citidine Deaminase Antibody (NBP2-39019) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Citidine Deaminase Products

Research Areas for Citidine Deaminase Antibody (NBP2-39019)

Find related products by research area.

Blogs on Citidine Deaminase

There are no specific blogs for Citidine Deaminase, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Citidine Deaminase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDA
Uniprot