KCNE1 Antibody (5B12)


Western Blot: KCNE1 Antibody (5B12) [H00003753-M01] - Analysis of KCNE1 over-expressed 293 cell line, cotransfected with KCNE1 Validated Chimera RNAi ( Cat # H00003753-R01V ) (Lane 2) or non-transfected control (Lane ...read more
Western Blot: KCNE1 Antibody (5B12) [H00003753-M01] - analysis of KCNE1 expression in transfected 293T cell line by KCNE1 monoclonal antibody (M01), clone 5B12. Lane 1: KCNE1 transfected lysate (14.7 KDa). Lane 2: ...read more
ELISA: KCNE1 Antibody (5B12) [H00003753-M01] - Detection limit for recombinant GST tagged KCNE1 is approximately 3ng/ml as a capture antibody.

Product Details

Reactivity Hu, Rt, Ca, Gp, PmSpecies Glossary
Applications WB, ELISA, ICC/IF, RNAi

Order Details

KCNE1 Antibody (5B12) Summary

KCNE1 (NP_000210, 67 a.a. ~ 129 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRSCYVVENHLAIEQPNTHLPETKPSP
KCNE1 (5B12)
IgG1 Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:500
  • Immunocytochemistry/Immunofluorescence
  • RNA Inhibition
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for RNAi Validation and ELISA.
Read Publications using H00003753-M01.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
In 1x PBS, pH 7.4
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for KCNE1 Antibody (5B12)

  • Delayed rectifier potassium channel subunit IsK
  • FLJ18426
  • FLJ38123
  • IKs producing slow voltage-gated potassium channel subunit beta Mink
  • ISK
  • Isk-related subfamily, member 1
  • JLNS2FLJ94103
  • LQT2/5
  • MGC33114
  • Minimal potassium channel
  • MinK
  • potassium voltage-gated channel, Isk-related family, member 1
  • voltage gated potassiun channel accessory subunit


The product of this gene belongs to the potassium channel KCNE family. Potassium ion channels are essential to many cellular functions and show a high degree of diversity, varying in their electrophysiologic and pharmacologic properties. This gene encodes a transmembrane protein known to associate with the product of the KVLQT1 gene to form the delayed rectifier potassium channel. Mutation in this gene are associated with both Jervell and Lange-Nielsen and Romano-Ward forms of long-QT syndrome. Alternatively spliced transcript variants encoding the same protein have been identified.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, RIA, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu, Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P, MiAr
Species: Hu, Rt, Ca, Gp, Pm
Applications: WB, ELISA, ICC/IF, RNAi

Publications for KCNE1 Antibody (H00003753-M01)(2)

Reviews for KCNE1 Antibody (H00003753-M01) (0)

There are no reviews for KCNE1 Antibody (H00003753-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for KCNE1 Antibody (H00003753-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional KCNE1 Products

Bioinformatics Tool for KCNE1 Antibody (H00003753-M01)

Discover related pathways, diseases and genes to KCNE1 Antibody (H00003753-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KCNE1 Antibody (H00003753-M01)

Discover more about diseases related to KCNE1 Antibody (H00003753-M01).

Pathways for KCNE1 Antibody (H00003753-M01)

View related products by pathway.

PTMs for KCNE1 Antibody (H00003753-M01)

Learn more about PTMs related to KCNE1 Antibody (H00003753-M01).

Blogs on KCNE1

There are no specific blogs for KCNE1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our KCNE1 Antibody (5B12) and receive a gift card or discount.


Gene Symbol KCNE1