NT5M Antibody - BSA Free

Immunohistochemistry-Paraffin: NT5M Antibody [NBP1-92203] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.

Analysis in control (vector only transfected HEK293T lysate) and NT5M over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NT5M Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NT5M Antibody - BSA Free (NBP1-92203) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKT
• Predicted Species: Mouse (95%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NT5M
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  NT5M Protein (NBP1-92203PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NT5M Antibody - BSA Free

• 3'-nucleotidase, mitochondrialDNT2
• 5' nucleotidase, mitochondrial
• 5'
• 5(3)-deoxyribonucleotidase
• Deoxy-5'-nucleotidase 2
• dNT2
• dNT-25'(3')-deoxyribonucleotidase, mitochondrial
• EC 3.1.3
• EC 3.1.3.-
• mdN
• mitochondrial 5' nucleotidase

Background

NT5M encodes a 5' nucleotidase that localizes to the mitochondrial matrix. This enzyme dephosphorylates the 5'- and 2'(3')-phosphates of uracil and thymine deoxyribonucleotides. The gene is located within the Smith-Magenis syndrome region on chromosome 17.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NT5M