ENT1 Antibody

Images

 
Immunohistochemistry-Paraffin: ENT1 Antibody [NBP1-84838] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ENT1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RLEFYRYYQQLKLEGPGEQETKLDLISKGEEPRAGKEESGVSVSNSQPTNESHSIKAILK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC29A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
Use in ICC/IF reported in scientific literature (PMID:34445661). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ENT1 Protein (NBP1-84838PEP)
Publications
Read Publication using
NBP1-84838 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ENT1 Antibody

  • ENT1
  • ENT1es-type
  • equilibrative nucleoside transporter 1
  • MGC1465
  • MGC3778
  • SLC29A1
  • solute carrier family 29 (nucleoside transporters), member 1
  • Solute carrier family 29 member 1
  • solute carrier family 29, member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-69313
Species: Hu
Applications: WB
NBP2-48480
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P
NBP2-38763
Species: Hu
Applications: IHC, IHC-P
NBP2-39019
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-30857
Species: Hu
Applications: IHC, IHC-P
NBP2-43639
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-31661
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF6240
Species: Hu
Applications: ELISA, IHC, WB
NBP2-20231
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-82073
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-84418
Species: Hu
Applications: IHC, IHC-P, WB
NB100-368
Species: Hu, Mu
Applications: WB
NBP3-08882
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PA, WB
NBP2-41314
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
AF1235
Species: Hu
Applications: IHC, WB
NBP2-81829
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-20813
Species: Hu, Mu
Applications: ICC/IF, WB
NBP1-87404
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
H00022978-M02
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB

Publications for ENT1 Antibody (NBP1-84838)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for ENT1 Antibody (NBP1-84838) (0)

There are no reviews for ENT1 Antibody (NBP1-84838). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ENT1 Antibody (NBP1-84838) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ENT1 Products

Bioinformatics Tool for ENT1 Antibody (NBP1-84838)

Discover related pathways, diseases and genes to ENT1 Antibody (NBP1-84838). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ENT1 Antibody (NBP1-84838)

Discover more about diseases related to ENT1 Antibody (NBP1-84838).
 

Pathways for ENT1 Antibody (NBP1-84838)

View related products by pathway.

PTMs for ENT1 Antibody (NBP1-84838)

Learn more about PTMs related to ENT1 Antibody (NBP1-84838).
 

Research Areas for ENT1 Antibody (NBP1-84838)

Find related products by research area.

Blogs on ENT1

There are no specific blogs for ENT1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ENT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC29A1