NT5C3 Antibody

Images

 
Western Blot: NT5C3 Antibody [NBP1-85525] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: NT5C3 Antibody [NBP1-85525] - Staining of human rectum shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NT5C3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RIKNPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDECRKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVMLKEGY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NT5C3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NT5C3 Protein (NBP1-85525PEP)
Publications
Read Publication using NBP1-85525.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NT5C3 Antibody

  • 5'-nucleotidase, cytosolic III
  • cN-IIIMGC87828
  • cytosolic 5'-nucleotidase 3
  • Cytosolic 5'-nucleotidase III
  • p36
  • P5N1
  • P5N-1
  • P5'N-1MGC27337
  • PN-IMGC87109
  • PSN1UMPH
  • Pyrimidine 5'-nucleotidase 1
  • UMPH1EC 3.1.3.5
  • uridine 5' monophosphate hydrolase 1
  • Uridine 5'-monophosphate hydrolase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-82458
Species: Hu
Applications: IHC, IHC-P
NBP1-57508
Species: Hu
Applications: WB, IHC, IHC-P
AF7250
Species: Hu
Applications: IHC
AF3770
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
H00000902-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-89790
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB6240
Species: Hu
Applications: WB, IHC
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-89530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2428
Species: Hu
Applications: WB
NBP1-92564
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91931
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-85525
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for NT5C3 Antibody (NBP1-85525)(1)

Reviews for NT5C3 Antibody (NBP1-85525) (0)

There are no reviews for NT5C3 Antibody (NBP1-85525). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NT5C3 Antibody (NBP1-85525) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NT5C3 Products

Bioinformatics Tool for NT5C3 Antibody (NBP1-85525)

Discover related pathways, diseases and genes to NT5C3 Antibody (NBP1-85525). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NT5C3 Antibody (NBP1-85525)

Discover more about diseases related to NT5C3 Antibody (NBP1-85525).
 

Pathways for NT5C3 Antibody (NBP1-85525)

View related products by pathway.

PTMs for NT5C3 Antibody (NBP1-85525)

Learn more about PTMs related to NT5C3 Antibody (NBP1-85525).

Blogs on NT5C3

There are no specific blogs for NT5C3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NT5C3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NT5C3