NRIP Antibody - BSA Free

Western Blot: NRIP Antibody [NBP2-87941] - Host: Rabbit. Target Name: IQWD1. Sample Type: OVCAR-3 Whole cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NRIP Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NRIP Antibody - BSA Free (NBP2-87941) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human NRIP. Peptide sequence: LMLEETRNTITVPASFMLRMLASLNHIRADRLEGDRSEGSGQENENEDEE The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DCAF6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NRIP Antibody - BSA Free

• 1200006M05Rik
• Androgen receptor complex-associated protein
• ARCAP
• DDB1 and CUL4 associated factor 6
• DDB1- and CUL4-associated factor 6
• FLJ23798
• IQ motif and WD repeat-containing protein 1
• IQ motif and WD repeats 1
• IQWD1
• MSTP055
• NRIP
• Nuclear receptor interaction protein
• PC326

Background

WD-repeat proteins are a large family of eukaryotic proteins coordinating multi-protein complex assemblies. Their role has been implicated in multiple cellular processes including signal transduction, transcriptional regulation, cell cycle control and apoptosis. NRIP is a novel 860a.a nuclear protein consisting of seven conserved WD40 domains and one NLS motif. It binds to androgen and glucocorticoid receptors and up-regulates their transcriptional activity, thereby functioning as a nuclear receptor co-activator. Role of NRIP has been implicated in cell growth and also in cervical and prostrate cancer, thus indicating a potential therapeutic intervention. Northern Blot analysis detects a high expression of NRIP in skeletal muscle and testis and low expression in heart, prostrate and adrenal gland.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DCAF6