NRF3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NRF3 Antibody [NBP2-30870] - Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm & vesicles.
Immunohistochemistry-Paraffin: NRF3 Antibody [NBP2-30870] - Staining of human esophagus shows strong cytoplasmic positivity in basal squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NRF3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LEGISLGDIPLPGSISDGMNSSAHYHVNFSQAISQDVNLHEAILLCPNNTFRRDPTARTSQSQEPFLQLNSHTTNPEQTLPGTNLTGFLSPVDNHMRNLTSQDLLYD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NFE2L3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NRF3 Protein (NBP2-30870PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NRF3 Antibody

  • NF-E2-related factor 3
  • NFE2-related factor 3
  • Nrf3
  • NRF3nuclear factor erythroid 2-related factor 3
  • nuclear factor (erythroid-derived 2)-like 3
  • Nuclear factor, erythroid derived 2, like 3
  • nuclear factor-erythroid 2 p45-related factor 3
  • nuclear factor-erythroid 2-related factor 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-82580
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
H00002551-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-55915
Species: Hu
Applications: WB, ICC/IF
NBP2-19586
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56565
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB100-345
Species: Hu
Applications: WB, ChIP, IP
AF6817
Species: Hu
Applications: WB
NBP2-24551
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB17791
Species: Hu, Mu
Applications: WB
NB100-416
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP
NBP2-01904
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-15019
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-19779
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB200-209
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-87814
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30870
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for NRF3 Antibody (NBP2-30870) (0)

There are no publications for NRF3 Antibody (NBP2-30870).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NRF3 Antibody (NBP2-30870) (0)

There are no reviews for NRF3 Antibody (NBP2-30870). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NRF3 Antibody (NBP2-30870) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NRF3 Products

Bioinformatics Tool for NRF3 Antibody (NBP2-30870)

Discover related pathways, diseases and genes to NRF3 Antibody (NBP2-30870). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NRF3 Antibody (NBP2-30870)

Discover more about diseases related to NRF3 Antibody (NBP2-30870).
 

Pathways for NRF3 Antibody (NBP2-30870)

View related products by pathway.

PTMs for NRF3 Antibody (NBP2-30870)

Learn more about PTMs related to NRF3 Antibody (NBP2-30870).
 

Research Areas for NRF3 Antibody (NBP2-30870)

Find related products by research area.

Blogs on NRF3

There are no specific blogs for NRF3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NRF3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NFE2L3
Uniprot