NRF3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: NRF3 Antibody [NBP2-30870] - Staining of human cell line CACO-2 shows localization to nucleoplasm & vesicles. Antibody staining shown in green.

(A) Pan-cancer analysis of NFE2L3 expression of all samples in TCGA. (B) Box plot of NFE2L3 expression in tumor tissues and paired normal tissues of samples from GSE51024 (C) Kaplan–Meier curve of patients from TCGA when using the median of NFE2L3 expression as the cut-off value. (D) Immunohistochemical staining of NFE2L3 in normal pleural epithelial tissue (black arrow) and malignant pleural mesothelioma tumor tissue (E) Kaplan–Meier curves depicting the relationships between DNA methylation levels of NFE2L3 related sites and prognosis of patients with MPM. Image collected and cropped by CiteAb from the following open publication (//pubmed.ncbi.nlm.nih.gov/35664314), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NRF3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LEGISLGDIPLPGSISDGMNSSAHYHVNFSQAISQDVNLHEAILLCPNNTFRRDPTARTSQSQEPFLQLNSHTTNPEQTLPGTNLTGFLSPVDNHMRNLTSQDLLYD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NFE2L3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NRF3 Protein (NBP2-30870PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NRF3 Antibody - BSA Free

• NF-E2-related factor 3
• NFE2-related factor 3
• Nrf3
• NRF3nuclear factor erythroid 2-related factor 3
• nuclear factor (erythroid-derived 2)-like 3
• Nuclear factor, erythroid derived 2, like 3
• nuclear factor-erythroid 2 p45-related factor 3
• nuclear factor-erythroid 2-related factor 3

Background

NFE2L3 - nuclear factor (erythroid-derived 2)-like 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NRF3 Antibody (NBP2-30870)(3)

Publications using NBP2-30870

• Wang Z, Yang H, Luo B et al. NFE2L3 as a Novel Biomarker Associated With IL-2/STAT5/NLRP3 Signaling Pathway in Malignant Pleural Mesothelioma and Other Cancers Frontiers in Genetics 2022-05-18 [PMID: 35664314] (Western Blot, Human)
• Xue H, Yu M, Zhou Y et al. Apolipoprotein M inhibits proliferation and migration of larynx carcinoma cells Sci Rep 2020-12-01 [PMID: 33173129] (WB, Human)
  
  Details:
  Western blot analysis performed on human vocal cord polyps and larynx cancer tissue.
• Yu MM, Feng YH, Zheng L et al. Short hairpin RNA-mediated knockdown of nuclear factor erythroid 2-like 3 exhibits tumor-suppressing effects in hepatocellular carcinoma cells World J. Gastroenterol. 2019-03-14 [PMID: 30886504] (WB, Human)

Bioinformatics

• Gene Symbol: NFE2L3
• Uniprot:
  • Q9Y4A8(Human)