Nuclear Factor Erythroid Derived 2 Antibody

Images

 
Western Blot: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580] - Analysis in human cell line HELA.
Immunohistochemistry-Paraffin: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580] - Immunohistochemical staining of human bone marrow shows moderate nuclear positivity in hematopoietic cells.
Simple Western: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580] - Simple Western lane view shows a specific band for NFE2 in 0.2 mg/ml of K-562 lysate. This experiment was performed under reducing conditions ...read more
Simple Western: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580] - Electropherogram image(s) of corresponding Simple Western lane view. Nuclear Factor Erythroid Derived 2 antibody was used at 1:20 dilution on ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Nuclear Factor Erythroid Derived 2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SRNRVIQLSTSELGEMELTWQEIMSITELQGLNAPSEPSFEPQAPAPYLGPPPPTTYCPCSIHPDSGFPLPPPPYELPASTSHVPDPPYSYGNMAIPVSKPLSLSGLLSEPLQDPLALLDIGLPAGPPKPQEDPES
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NFE2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Simple Western 1:20
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. br/>In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Control Peptide
Nuclear Factor Erythroid Derived 2 Protein (NBP1-82580PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Nuclear Factor Erythroid Derived 2 Antibody

  • Leucine zipper protein NF-E2
  • NF-E2
  • nuclear factor (erythroid-derived 2), 45kD
  • nuclear factor (erythroid-derived 2), 45kDa
  • Nuclear factor, erythroid-derived 2 45 kDa subunit
  • p45 NF-E2
  • p45
  • transcription factor NF-E2 45 kDa subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB17791
Species: Hu, Mu
Applications: WB
NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-14081
Species: Hu
Applications: IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
H00002551-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
MAB3809
Species: Hu, Mu
Applications: WB
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-55915
Species: Hu
Applications: WB, ICC/IF
NBP2-24551
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-56530
Species: Hu
Applications: WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19586
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-37380
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready

Publications for Nuclear Factor Erythroid Derived 2 Antibody (NBP1-82580) (0)

There are no publications for Nuclear Factor Erythroid Derived 2 Antibody (NBP1-82580).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nuclear Factor Erythroid Derived 2 Antibody (NBP1-82580) (0)

There are no reviews for Nuclear Factor Erythroid Derived 2 Antibody (NBP1-82580). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nuclear Factor Erythroid Derived 2 Antibody (NBP1-82580) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Nuclear Factor Erythroid Derived 2 Products

Bioinformatics Tool for Nuclear Factor Erythroid Derived 2 Antibody (NBP1-82580)

Discover related pathways, diseases and genes to Nuclear Factor Erythroid Derived 2 Antibody (NBP1-82580). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nuclear Factor Erythroid Derived 2 Antibody (NBP1-82580)

Discover more about diseases related to Nuclear Factor Erythroid Derived 2 Antibody (NBP1-82580).
 

Pathways for Nuclear Factor Erythroid Derived 2 Antibody (NBP1-82580)

View related products by pathway.

PTMs for Nuclear Factor Erythroid Derived 2 Antibody (NBP1-82580)

Learn more about PTMs related to Nuclear Factor Erythroid Derived 2 Antibody (NBP1-82580).

Blogs on Nuclear Factor Erythroid Derived 2

There are no specific blogs for Nuclear Factor Erythroid Derived 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nuclear Factor Erythroid Derived 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NFE2