Skp2 Antibody

Images

 
Western Blot: Skp2 Antibody [NBP2-49142] - Analysis in Rh30 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-SKP2 antibody. Remaining relative intensity is presented. Loading ...read more
Immunohistochemistry-Paraffin: Skp2 Antibody [NBP2-49142] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: Skp2 Antibody [NBP2-49142] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: Skp2 Antibody [NBP2-49142] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Skp2 Antibody [NBP2-49142] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Skp2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLS
Specificity
Specificity of human Skp2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SKP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Skp2 Recombinant Protein Antigen (NBP2-49142PEP)

Reactivity Notes

Mouse (82%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Skp2 Antibody

  • CDK2/cyclin A-associated protein p45
  • cyclin A/CDK2-associated protein p45
  • Cyclin-A/CDK2-associated protein p45
  • FBL1
  • F-box protein Skp2
  • F-box/LRR-repeat protein 1
  • FBXL1
  • FBXL1MGC1366
  • FLB1
  • p45skp2
  • Skp2
  • S-phase kinase-associated protein 2 (p45)
  • S-phase kinase-associated protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1555
Species: Hu
Applications: WB
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90949
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-03198
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB7557
Species: Hu
Applications: WB, IHC
NBP2-00776
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
H00027065-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
H00001163-B01P
Species: Hu, Rt
Applications: WB
NBP2-75458
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-82580
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA

Publications for Skp2 Antibody (NBP2-49142) (0)

There are no publications for Skp2 Antibody (NBP2-49142).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Skp2 Antibody (NBP2-49142) (0)

There are no reviews for Skp2 Antibody (NBP2-49142). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Skp2 Antibody (NBP2-49142) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Skp2 Products

Bioinformatics Tool for Skp2 Antibody (NBP2-49142)

Discover related pathways, diseases and genes to Skp2 Antibody (NBP2-49142). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Skp2 Antibody (NBP2-49142)

Discover more about diseases related to Skp2 Antibody (NBP2-49142).
 

Pathways for Skp2 Antibody (NBP2-49142)

View related products by pathway.

PTMs for Skp2 Antibody (NBP2-49142)

Learn more about PTMs related to Skp2 Antibody (NBP2-49142).
 

Research Areas for Skp2 Antibody (NBP2-49142)

Find related products by research area.

Blogs on Skp2.

Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Skp2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SKP2