NPAS1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NPAS1 Antibody [NBP2-58842] - Staining of human cell line HEK 293 shows localization to nucleoplasm.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NPAS1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VLWVSHVLSQAEGGQTPLDAFQLPASVACEEASSPGPEPTEPEPPTEGKQAAPAENEAPQTQGQRIKV
Specificity
Specificity of human NPAS1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NPAS1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NPAS1 Recombinant Protein Antigen (NBP2-58842PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for NPAS1 Antibody

  • Basic-helix-loop-helix-PAS protein MOP5
  • BHLHE11
  • bHLHe11member of PAS superfamily 5
  • Class E basic helix-loop-helix protein 11
  • Member of PAS protein 5
  • MOP5Neuronal PAS1
  • neuronal PAS domain protein 1
  • neuronal PAS domain-containing protein 1
  • PASD5PAS domain-containing protein 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-124
Species: Hu, Mu, Rt, Bv, Ma, Pm, Sh
Applications: WB, ChIP, GS, IB, ICC/IF, IHC, IHC-P, IP, CHIP-SEQ
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC, IHC-FrFl, IHC-WhMt, KO
NBP1-88622
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ca, Fe, Ma, Pm, Pm, Rb, Sh, Xp
Applications: WB, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, TCS, KD, KO, LA
NBP1-30052
Species: Hu, Mu, Rt, Ch, Gp, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl, IHC-WhMt
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IF
NBP2-50465
Species: Hu
Applications: Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
H00023316-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, S-ELISA
NBP1-88623
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13967
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-27559
Species: Hu
Applications: WB, PEP-ELISA
AF7068
Species: Hu
Applications: WB, IHC, ICC
NBP2-01793
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB200-526
Species: Hu
Applications: WB, IHC, IHC-P, IF
NBP1-31363
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88619
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-03688
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58842
Species: Hu
Applications: ICC/IF

Publications for NPAS1 Antibody (NBP2-58842) (0)

There are no publications for NPAS1 Antibody (NBP2-58842).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NPAS1 Antibody (NBP2-58842) (0)

There are no reviews for NPAS1 Antibody (NBP2-58842). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NPAS1 Antibody (NBP2-58842) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NPAS1 Products

Bioinformatics Tool for NPAS1 Antibody (NBP2-58842)

Discover related pathways, diseases and genes to NPAS1 Antibody (NBP2-58842). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NPAS1 Antibody (NBP2-58842)

Discover more about diseases related to NPAS1 Antibody (NBP2-58842).
 

Pathways for NPAS1 Antibody (NBP2-58842)

View related products by pathway.

Blogs on NPAS1

There are no specific blogs for NPAS1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NPAS1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NPAS1