NPAS2 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: SKPEFIVCTHSVVSYADVRVERRQELALEDPPSEALHSSALKDKGSSLEPRQHFNTLDVGASGLNTSHSPSASSRSSHKSSHTAMSEPTSTPTKLMAEASTPALPRSATLPQELPVP |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
NPAS2 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100 |
Control Peptide |
|
Reactivity Notes
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for NPAS2 Antibody
Background
NPAS2 is encoded by this gene is a member of the basic helix-loop-helix (bHLH)-PAS family of transcription factors. A similar mouse protein may play a regulatory role in the acquisition of specific types of memory. It also may function as a part of a molecular clock operative in the mammalian forebrain.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Pm, Rt
Applications: ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ChIP, WB
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: IB, IHC, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: DB, ELISA, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IF, IHC, IHC-P, IP, PLA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Eq, Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ChIP, CHIP-SEQ, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, KD, WB
Species: Mu
Applications: IHC
Species: Hu
Applications: ELISA, ICC/IF, WB
Publications for NPAS2 Antibody (NBP1-88612) (0)
There are no publications for NPAS2 Antibody (NBP1-88612).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NPAS2 Antibody (NBP1-88612) (0)
There are no reviews for NPAS2 Antibody (NBP1-88612).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NPAS2 Antibody (NBP1-88612) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional NPAS2 Products
Bioinformatics Tool for NPAS2 Antibody (NBP1-88612)
Discover related pathways, diseases and genes to NPAS2 Antibody (NBP1-88612). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for NPAS2 Antibody (NBP1-88612)
Discover more about diseases related to NPAS2 Antibody (NBP1-88612).
| | Pathways for NPAS2 Antibody (NBP1-88612)
View related products by pathway.
|
PTMs for NPAS2 Antibody (NBP1-88612)
Learn more about PTMs related to NPAS2 Antibody (NBP1-88612).
|
Blogs on NPAS2