NPAS2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NPAS2 Antibody [NBP1-88612] - Staining of mouse somatosensory cortex shows nuclear immunoreactivity in neurons.
Immunohistochemistry-Paraffin: NPAS2 Antibody [NBP1-88612] - Staining of human cerebral cortex shows nuclear positivity.
Immunocytochemistry/ Immunofluorescence: NPAS2 Antibody [NBP1-88612] - Staining of mouse hippocampus shows nuclear positivity in the CA3/CA2 neurons.
Immunocytochemistry/ Immunofluorescence: NPAS2 Antibody [NBP1-88612] - Staining of mouse midbrain shows strong positivity in locus coeruleus neurons.
Immunocytochemistry/ Immunofluorescence: NPAS2 Antibody [NBP1-88612] - Staining of mouse periaqueductal grey shows nuclear immunoreactivity in neurons.
Immunocytochemistry/ Immunofluorescence: NPAS2 Antibody [NBP1-88612] - Staining of mouse pons shows nuclear positivity in the neurons of dorsal motor nucleus of vagus.
Immunocytochemistry/ Immunofluorescence: NPAS2 Antibody [NBP1-88612] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: NPAS2 Antibody [NBP1-88612] - Staining of human adrenal gland shows strong nuclear and cytoplasmic positivity in cortical cells.
Immunohistochemistry-Paraffin: NPAS2 Antibody [NBP1-88612] - Staining of human cerebellum shows nuclear positivity in Purkinje cells and in the molecular layer neurons.
Immunohistochemistry-Paraffin: NPAS2 Antibody [NBP1-88612] - Staining of human cerebral cortex shows moderate positivity in neurons.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NPAS2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SKPEFIVCTHSVVSYADVRVERRQELALEDPPSEALHSSALKDKGSSLEPRQHFNTLDVGASGLNTSHSPSASSRSSHKSSHTAMSEPTSTPTKLMAEASTPALPRSATLPQELPVP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NPAS2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NPAS2 Protein (NBP1-88612PEP)

Reactivity Notes

Rat (87%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NPAS2 Antibody

  • Basic-helix-loop-helix-PAS protein MOP4
  • BHLHE9
  • bHLHe9MGC71151
  • Class E basic helix-loop-helix protein 9
  • Member of PAS protein 4
  • member of PAS superfamily 4
  • MOP4PAS domain-containing protein 4
  • neuronal PAS domain protein 2
  • neuronal PAS domain-containing protein 2
  • Neuronal PAS2
  • PASD4FLJ23138

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2288
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-125
Species: Hu
Applications: WB, ICC/IF
NB100-126
Species: Hu, Mu
Applications: WB, ChIP
NBP2-24589
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, IHC-P
NBP1-86692
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3764
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-00749
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00008863-B01P
Species: Hu
Applications: WB, ICC/IF
NB100-135
Species: Hu, Pm, Bv(-), Ch(-), Rt(-), Ze(-)
Applications: WB, ICC/IF
NBP2-32423
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
NBP1-88027
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-19613
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB100-1800
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC-P, IP
H00009572-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-1269
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for NPAS2 Antibody (NBP1-88612) (0)

There are no publications for NPAS2 Antibody (NBP1-88612).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NPAS2 Antibody (NBP1-88612) (0)

There are no reviews for NPAS2 Antibody (NBP1-88612). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NPAS2 Antibody (NBP1-88612) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NPAS2 Products

Bioinformatics Tool for NPAS2 Antibody (NBP1-88612)

Discover related pathways, diseases and genes to NPAS2 Antibody (NBP1-88612). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NPAS2 Antibody (NBP1-88612)

Discover more about diseases related to NPAS2 Antibody (NBP1-88612).
 

Pathways for NPAS2 Antibody (NBP1-88612)

View related products by pathway.

PTMs for NPAS2 Antibody (NBP1-88612)

Learn more about PTMs related to NPAS2 Antibody (NBP1-88612).

Blogs on NPAS2

There are no specific blogs for NPAS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NPAS2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NPAS2