LHX6 Antibody

Images

 
Western Blot: LHX6 Antibody [NB200-526] - Sample Tissue: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5ug/mL, Peptide Concentration: 2.0ug/mL, Lysate ...read more
Immunohistochemistry-Paraffin: LHX6 Antibody [NB200-526] - Human Liver Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Hepatocytes (indicated with arrows) 400X magnification.
Western Blot: LHX6 Antibody [NB200-526] - HepG2 cell lysate, Antibody Titration: 1.0ug/ml
Western Blot: LHX6 Antibody [NB200-526] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
1 mg/ml

Order Details

LHX6 Antibody Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human LHX6. Peptide Sequence LSRRVIQVWFQNCRARHKKHTPQHPVPPSGAPPSRLPSALSDDIHYTPFS. The peptide sequence for this immunogen was taken from within the described region.
Localization
Nuclear
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LHX6
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4-8 ug/ml
  • Western Blot 1.0 ug/ml
Application Notes
WB: Use in 5% skim milk / PBS buffer. Detects a band of approximately 50 kDa. Optimal dilutions/concentrations should be determined by the end user.
Theoretical MW
40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
1 mg/ml
Purity
Protein A purified

Alternate Names for LHX6 Antibody

  • LHX6.1LIM homeobox protein 6
  • LIM homeobox 6
  • LIM homeodomain protein 6.1
  • LIM/homeobox protein Lhx6
  • LIM/homeobox protein Lhx6.1
  • MGC119542
  • MGC119544
  • MGC119545

Background

LHX6 is a member of a large protein family that contains the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptional regulator and may be involved in the control of differentiation and development of neural and lymphoid cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LHX6 Antibody (NB200-526) (0)

There are no publications for LHX6 Antibody (NB200-526).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LHX6 Antibody (NB200-526) (0)

There are no reviews for LHX6 Antibody (NB200-526). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LHX6 Antibody (NB200-526) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LHX6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LHX6
Entrez