LHX6 Antibody

Western Blot: LHX6 Antibody [NB200-526] - Sample Tissue: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5ug/mL, Peptide Concentration: 2.0ug/mL, Lysate Quantity: 25ug/lane, Gel Concentration: 12%

Immunohistochemistry-Paraffin: LHX6 Antibody [NB200-526] - Human Liver Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Hepatocytes (indicated with arrows) 400X magnification.

Western Blot: LHX6 Antibody [NB200-526] - HepG2 cell lysate, Antibody Titration: 1.0ug/ml

Western Blot: LHX6 Antibody [NB200-526] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

LHX6 Antibody Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human LHX6. Peptide Sequence LSRRVIQVWFQNCRARHKKHTPQHPVPPSGAPPSRLPSALSDDIHYTPFS. The peptide sequence for this immunogen was taken from within the described region.
• Localization: Nuclear
• Specificity: LHX6
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LHX6
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4-8 ug/ml
  • Western Blot 1.0 ug/ml
• Application Notes: WB: Use in 5% skim milk / PBS buffer. Detects a band of approximately 50 kDa. Optimal dilutions/concentrations should be determined by the end user.
• Theoretical MW: 40 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for LHX6 Antibody

• LHX6.1LIM homeobox protein 6
• LIM homeobox 6
• LIM homeodomain protein 6.1
• LIM/homeobox protein Lhx6
• LIM/homeobox protein Lhx6.1
• MGC119542
• MGC119544
• MGC119545

Background

LHX6 is a member of a large protein family that contains the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptional regulator and may be involved in the control of differentiation and development of neural and lymphoid cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LHX6
• Entrez:
  • 26468(Human)