![Immunocytochemistry/Immunofluorescence: Notch-1 Antibody [NBP2-57913] - Staining of human cell line HaCaT shows localization to nucleoplasm.](http://images.novusbio.com/fullsize2/Notch-1 Antibody-Immunocytochemistry-Immunofluorescence-NBP2-57913-img0001.jpg "Immunocytochemistry/Immunofluorescence: Notch-1 Antibody [NBP2-57913] - Staining of human cell line HaCaT shows localization to nucleoplasm.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GGSTSLNGQCEWLSRLQSGMVPNQYNPLRGSVAPGPLSTQAPSLQHGMVGPLHSSLAASALSQMMSYQGLPSTRLATQPHLVQTQQVQPQNLQMQQQNL |
| Specificity | Specificity of human Notch-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NOTCH1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for Notch-1 Antibody (NBP2-57913)Discover more about diseases related to Notch-1 Antibody (NBP2-57913).
| Pathways for Notch-1 Antibody (NBP2-57913)View related products by pathway.
|
PTMs for Notch-1 Antibody (NBP2-57913)Learn more about PTMs related to Notch-1 Antibody (NBP2-57913).
| Research Areas for Notch-1 Antibody (NBP2-57913)Find related products by research area.
|
|
Notch1 - A multifunctional transmembrane receptor Notch1 is a member of the Notch family of Type 1 single-pass transmembrane proteins that share an extracellular domain of multiple epidermal growth factor-like (EGF) repeats. Notch family members play key roles in a variety of developmental process... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NOTCH1 |
![Western Blot: HES-1 Antibody (OTI4H1) [NBP1-47791] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY HES1 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-HES1 (1:500).](http://images.novusbio.com/images2/HES-1-Antibody-(OTI4H1)-Western-Blot-NBP1-47791-img0018.jpg)
![Immunocytochemistry/Immunofluorescence: HES-1 Antibody (OTI4H1) [NBP1-47791] - HeLa cells using anti-HES1 mouse monoclonal antibody.](http://images.novusbio.com/images2/HES-1-Antibody-(OTI4H1)-Immunocytochemistry-Immunofluorescence-NBP1-47791-img0010.jpg)
![Immunohistochemistry-Paraffin: HES-1 Antibody (OTI4H1) [NBP1-47791] - Staining of paraffin-embedded liver using anti-Hes1 mouse monoclonal antibody.](http://images.novusbio.com/images2/HES-1-Antibody-(OTI4H1)-Immunohistochemistry-Paraffin-NBP1-47791-img0015.jpg)
![Western Blot: Notch-4 Antibody [NB100-93551] - Analysis of Notch-4 in 1. Jurkat 2. U937 3. WEHI 4. Raw267 cell lysates.](http://images.novusbio.com/images2/Notch-4-Antibody-Western-Blot-NB100-93551-img0007.jpg)
![Immunocytochemistry/Immunofluorescence: Notch-4 Antibody [NB100-93551] - Notch-4 antibody (1:500) was tested in HeLa cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red). Image objective 20x.](http://images.novusbio.com/images2/Notch-4-Antibody-Immunocytochemistry-Immunofluorescence-NB100-93551-img0005.jpg)
![Immunohistochemistry-Paraffin: Notch-4 Antibody [NB100-93551] - Analysis of Notch-4 in human intestine.](http://images.novusbio.com/images2/Notch-4-Antibody-Immunohistochemistry-Paraffin-NB100-93551-img0006.jpg)
![Western Blot: C21orf33 Antibody (1F5) [H00008209-M01] - C21orf33 monoclonal antibody (M01), clone 1F5 Analysis of C21orf33 expression in HeLa.](http://images.novusbio.com/images2/C21orf33-Antibody-(1F5)-Western-Blot-H00008209-M01-img0010.jpg)
![Immunocytochemistry/Immunofluorescence: C21orf33 Antibody (1F5) [H00008209-M01] - Analysis of monoclonal antibody to C21orf33 on HeLa cell. Antibody concentration 10 ug/ml.](http://images.novusbio.com/images2/C21orf33-Antibody-(1F5)-Immunocytochemistry-Immunofluorescence-H00008209-M01-img0006.jpg)
![Immunohistochemistry-Paraffin: C21orf33 Antibody (1F5) [H00008209-M01] - Analysis of monoclonal antibody to C21orf33 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.](http://images.novusbio.com/images2/C21orf33-Antibody-(1F5)-Immunohistochemistry-Paraffin-H00008209-M01-img0008.jpg)
![Western Blot: Presenilin-1 Antibody (APS 18) [NB100-74510] - Analysis of THP-1 cell lysate.](http://images.novusbio.com/images2/Presenilin-1-Antibody-(APS-18)-Western-Blot-NB100-74510-img0013.jpg)
![Immunocytochemistry/Immunofluorescence: Presenilin-1 Antibody (APS 18) [NB100-74510] - Analysis of Presenilin 1 using Presenilin 1 Monoclonal antibody (APS 18) shows staining in A2058 melanoma cells. Presenilin 1 staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Presenilin 1 at a dilution of 1:20-1:100 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.](http://images.novusbio.com/images2/Presenilin-1-Antibody-(APS-18)-Immunocytochemistry-Immunofluorescence-NB100-74510-img0022.jpg)
![Immunohistochemistry-Paraffin: Presenilin-1 Antibody (APS 18) [NB100-74510] - Normal biopsies of deparaffinized Human liver tissue.](http://images.novusbio.com/images2/Presenilin-1-Antibody-(APS-18)-Immunohistochemistry-Paraffin-NB100-74510-img0024.jpg)
![ELISA: Notch-3 Antibody (1G5) [H00004854-M01] - Detection limit for recombinant GST tagged NOTCH3 is approximately 0.03ng/ml as a capture antibody.](http://images.novusbio.com/images2/Notch-3-Antibody-(1G5)-ELISA-H00004854-M01-img0003.jpg)
![Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1 (HJ21)) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).](http://images.novusbio.com/images2/p21-CIP1-CDKN1A-Antibody-(WA-1-(HJ21))-Immunohistochemistry-Paraffin-NBP2-29463-img0001.jpg)
![Western Blot: FBXW7/Cdc4 Antibody [NBP1-59631] - Sample Type: Human Fetal Heart Antibody Dilution: 1.0 ug/ml](http://images.novusbio.com/images2/FBXW7-Cdc4-Antibody-Western-Blot-NBP1-59631-img0013.jpg)
![Immunohistochemistry: FBXW7/Cdc4 Antibody [NBP1-59631] - Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue Observed Staining: Cytoplasmic in cell bodies and processes of pinealocytes Primary Antibody Concentration: 1:100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec](http://images.novusbio.com/images2/FBXW7-Cdc4-Antibody-Immunohistochemistry-NBP1-59631-img0012.jpg)
![Western Blot: FBXW7/Cdc4 Antibody [NBP1-59631] - Jurkat cell lysate.](http://images.novusbio.com/images2/FBXW7-Cdc4-Antibody-Western-Blot-NBP1-59631-img0007.jpg)
![Western Blot: c-Myc Antibody (9E10) [NB600-302] - CtIP is phosphorylated by CDKs at multiple sites. Myc-BRCA1 and/or HA-CtIP WT or indicated mutants were expressed in 293T cells and co-immunoprecipitation was performed. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pgen.1003277) licensed under a CC-BY licence.](http://images.novusbio.com/images2/c-Myc-Antibody-(9E10)-Western-Blot-NB600-302-img0022.jpg)
![Immunohistochemistry-Paraffin: c-Myc Antibody (9E10) [NB600-302] - c-Myc was detected in immersion fixed paraffin-embedded sections of human breast cancer using anti-human mouse monoclonal antibody (Catalog # NB600-302, clone 9E10) at 1:50 dilution overnight at 4 C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.](http://images.novusbio.com/images2/c-Myc-Antibody-(9E10)-Immunohistochemistry-Paraffin-NB600-302-img0009.jpg)
![Simple Western: c-Myc Antibody (9E10) [NB600-302] - Simple Western lane view shows a specific band for c-Myc in 0.5 mg/ml of Jurkat lysate. This experiment as performed under reducing conditions using the 12-230 kDa separation system.](http://images.novusbio.com/images2/c-Myc-Antibody-(9E10)-Simple-Western-NB600-302-img0006.jpg)
![Western Blot: p53 Antibody (PAb 240) [NB200-103] - Analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.](http://images.novusbio.com/images2/p53-Antibody-(PAb-240)-Western-Blot-NB200-103-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - PC12 cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-p53 Antibody (PAb 240) NB200-103 at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.](http://images.novusbio.com/images2/p53-Antibody-(PAb-240)-Immunocytochemistry-Immunofluorescence-NB200-103-img0013.jpg)
![Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.](http://images.novusbio.com/images2/p53-Antibody-(PAb-240)-Immunohistochemistry-Paraffin-NB200-103-img0005.jpg)
![Immunohistochemistry: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - IHC analysis of beta Amyloid on normal mouse brain (left) and 5xFAD mouse brain (right) using DAB with hematoxylin counterstain. The MOAB-2 antibody was used at 1:20 on normal mouse brain and at 1:400 on 5xFAD mouse brain.](http://images.novusbio.com/images2/beta-Amyloid-Antibody-(MOAB-2)-Immunohistochemistry-NBP2-13075-img0014.jpg)
![Western Blot: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - Analysis of beta Amyloid (MOAB-2) antibody in (1) 100 pmole beta Amyloid 42, (2) 5xFAD mouse brain homogenate Repetition 1 and (3) 5xFAD mouse brain homogenate Repetition 2.](http://images.novusbio.com/images2/beta-Amyloid-Antibody-(MOAB-2)-Western-Blot-NBP2-13075-img0017.jpg)
![Western Blot: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - Western blot analysis in cell lysates from HEK-APP SWE/BACE1 cells probed with an antibody against the C-terminus of APP (Lanes 1 and 2) and beta Amyloid (MOAB-2, Lanes 3 and 4). Beta Amyloid (MOAB-2) does not detect APP (from PMID: 22423893).](http://images.novusbio.com/images2/beta-Amyloid-Antibody-(MOAB-2)-Western-Blot-NBP2-13075-img0016.jpg)
![Western Blot: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in the following cell lysates: 1) human spleen 2) human tonsil 3) human placenta 4) human kidney 5) human liver 6) mouse spleen 7) mouse placenta 8) rat placenta.](http://images.novusbio.com/images2/CD4-Antibody-Western-Blot-NBP1-19371-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in Jurkat cells with DyLight 488 (green). Nuclei were counterstained with DAPI (blue).](http://images.novusbio.com/images2/CD4-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-19371-img0005.jpg)
![Immunohistochemistry-Paraffin: CD4 Antibody [NBP1-19371] - Alcohol-fixed paraffin-embedded rat spleen tissue. Dilution 1:150. Image from verified customer review.](http://images.novusbio.com/images2/CD4-Antibody-Immunohistochemistry-Paraffin-NBP1-19371-img0014.jpg)
![Western Blot: HES5 Antibody [NBP2-41305] - Western blot analysis of HES5 in Raji cell lysate with HES5 antibody at 1 ug/ml (A) the absence and (B) the presence of blocking peptide.](http://images.novusbio.com/images2/HES5-Antibody-Western-Blot-NBP2-41305-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: HES5 Antibody [NBP2-41305] - Staining of HES5 in mouse brain tissue with at 20 ug/mL.](http://images.novusbio.com/images2/HES5-Antibody-Immunofluorescence-NBP2-41305-img0004.jpg)
![Immunohistochemistry-Paraffin: HES5 Antibody [NBP2-41305] - Staining of HES5 in mouse brain tissue with at 5 ug/mL.](http://images.novusbio.com/images2/HES5-Antibody-Immunohistochemistry-NBP2-41305-img0005.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0006.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.")