Notch-1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Notch-1 Antibody [NBP2-57913] - Staining of human cell line HaCaT shows localization to nucleoplasm.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Notch-1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GGSTSLNGQCEWLSRLQSGMVPNQYNPLRGSVAPGPLSTQAPSLQHGMVGPLHSSLAASALSQMMSYQGLPSTRLATQPHLVQTQQVQPQNLQMQQQNL
Specificity
Specificity of human Notch-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NOTCH1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Notch-1 Recombinant Protein Antigen (NBP2-57913PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Notch-1 Antibody

  • EC 2.1.2.11
  • EC 3.4.21.68
  • hN1
  • Notch (Drosophila) homolog 1 (translocation-associated)
  • notch 1Notch homolog 1, translocation-associated (Drosophila)
  • Notch homolog 1, translocation-associated
  • Notch1
  • Notch-1
  • TAN1
  • TAN1neurogenic locus notch homolog protein 1
  • Translocation-associated notch protein TAN-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47791
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB100-93551
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1190
Species: Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
AF4079
Species: Hu
Applications: WB, ICC
H00008209-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NB100-74510
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00004854-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, S-ELISA
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-59631
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-302
Species: Hu, Mu, Bv, Dr
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, S-ELISA, Flow-IC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-13075
Species: Hu, Mu, Rt, Pm
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-41305
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-57913
Species: Hu
Applications: ICC/IF

Publications for Notch-1 Antibody (NBP2-57913) (0)

There are no publications for Notch-1 Antibody (NBP2-57913).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Notch-1 Antibody (NBP2-57913) (0)

There are no reviews for Notch-1 Antibody (NBP2-57913). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Notch-1 Antibody (NBP2-57913). (Showing 1 - of FAQ).

    Secondary Antibodies

     

    Isotype Controls

    Other Available Formats

    Additional Notch-1 Products

    Bioinformatics Tool for Notch-1 Antibody (NBP2-57913)

    Discover related pathways, diseases and genes to Notch-1 Antibody (NBP2-57913). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
    Visit Tool

    Diseases for Notch-1 Antibody (NBP2-57913)

    Discover more about diseases related to Notch-1 Antibody (NBP2-57913).
     

    Pathways for Notch-1 Antibody (NBP2-57913)

    View related products by pathway.

    PTMs for Notch-1 Antibody (NBP2-57913)

    Learn more about PTMs related to Notch-1 Antibody (NBP2-57913).
     

    Research Areas for Notch-1 Antibody (NBP2-57913)

    Find related products by research area.

    Blogs on Notch-1.

    Notch1 - A multifunctional transmembrane receptor
    Notch1 is a member of the Notch family of Type 1 single-pass transmembrane proteins that share an extracellular domain of multiple epidermal growth factor-like (EGF) repeats. Notch family members play key roles in a variety of developmental process...  Read full blog post.

    Coronavirus Brochure

    Customers Who Bought This Also Bought

    Contact Information

    Learn the difference between western blot and simple western

    Product PDFs

    Calculators

    Concentration Calculator

    The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

    =
    ÷

    Review this Product

    Be the first to review our Notch-1 Antibody and receive a gift card or discount.

    Bioinformatics

    Gene Symbol NOTCH1